Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NLRX1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86UT6
Molecular weight:
36.07 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Arg667–Ser975
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NLRX1 Protein, N-His

Product name ARO-P12406-100
Uniprot ID Q86UT6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSLTEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQLGSSGS
Molecular weight 36.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg667-Ser975
Aliases /Synonyms NLR family member X1, NOD5, Caterpiller protein 11.3, NOD9, Nucleotide-binding oligomerization domain protein 9, NLRX1, Nucleotide-binding oligomerization domain protein 26, Nucleotide-binding oligomerization domain protein 5, NOD26, CLR11.3
Reference ARO-P12406
Note For research use only.
Molecular Constructor
Arg667–Ser975
Product name ARO-P12406-1MG
Uniprot ID Q86UT6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSLTEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQLGSSGS
Molecular weight 36.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg667-Ser975
Aliases /Synonyms NLR family member X1, NOD5, Caterpiller protein 11.3, NOD9, Nucleotide-binding oligomerization domain protein 9, NLRX1, Nucleotide-binding oligomerization domain protein 26, Nucleotide-binding oligomerization domain protein 5, NOD26, CLR11.3
Reference ARO-P12406
Note For research use only.
Molecular Constructor
Arg667–Ser975
Product name ARO-P12406-50
Uniprot ID Q86UT6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSLTEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQLGSSGS
Molecular weight 36.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg667-Ser975
Aliases /Synonyms NLR family member X1, NOD5, Caterpiller protein 11.3, NOD9, Nucleotide-binding oligomerization domain protein 9, NLRX1, Nucleotide-binding oligomerization domain protein 26, Nucleotide-binding oligomerization domain protein 5, NOD26, CLR11.3
Reference ARO-P12406
Note For research use only.
Molecular Constructor
Arg667–Ser975

Introduction

Recombinant Human NLRX1 Protein, also known as NOD-like receptor X1, is a protein that plays a crucial role in the innate immune response. It is a member of the NOD-like receptor (NLR) family, which are cytosolic pattern recognition receptors (PRRs) involved in recognizing and responding to pathogen-associated molecular patterns (PAMPs). NLRX1 is involved in regulating various cellular processes, including inflammation, apoptosis, and autophagy. In this article, we will discuss the structure, activity, and applications of Recombinant Human NLRX1 Protein.

Structure of Recombinant Human NLRX1 Protein

NLRX1 is a 108 kDa protein that consists of 977 amino acids. It contains an N-terminal caspase recruitment domain (CARD), a central nucleotide-binding and oligomerization domain (NOD), and a C-terminal leucine-rich repeat (LRR) domain. The CARD domain is responsible for protein-protein interactions, while the NOD domain binds to nucleotides and mediates oligomerization. The LRR domain is involved in ligand recognition and downstream signaling.

Activity of Recombinant Human NLRX1 Protein

NLRX1 is primarily expressed in the mitochondria and has been shown to regulate mitochondrial dynamics and function. It acts as a negative regulator of the innate immune response by inhibiting the production of pro-inflammatory cytokines and type I interferons. NLRX1 accomplishes this by interacting with key signaling molecules, such as the mitochondrial antiviral signaling protein (MAVS) and the TNF receptor-associated factor 3 (TRAF3). These interactions prevent the activation of downstream signaling pathways, such as the NF-κB and IRF3 pathways, which are responsible for the production of pro-inflammatory cytokines and type I interferons, respectively.

NLRX1 also plays a role in regulating autophagy, a cellular process involved in the degradation of damaged organelles and pathogens. It has been shown to interact with the autophagy protein Beclin-1, leading to the inhibition of autophagy. This suggests that NLRX1 may play a role in regulating the balance between inflammation and autophagy in response to infection.

Applications of Recombinant Human NLRX1 Protein

Recombinant Human NLRX1 Protein has various applications in both basic research and clinical settings. It can be used to study the role of NLRX1 in regulating the innate immune response and its interactions with other signaling molecules. It can also be used to investigate the role of NLRX1 in mitochondrial dynamics and autophagy.

In addition, NLRX1 has been implicated in several diseases, including autoimmune disorders, infectious diseases, and cancer. Therefore, Recombinant Human NLRX1 Protein can be used to study the potential therapeutic effects of targeting NLRX1 in these diseases. For example, in autoimmune disorders, NLRX1 may be a potential target for reducing inflammation and preventing tissue damage. In infectious diseases, targeting NLRX1 may enhance the immune response and aid in pathogen clearance. In cancer, NLRX1 may play a role in tumor growth and progression, making it a potential target for cancer therapy.

Conclusion

Recombinant Human NLRX1 Protein is a key player in the innate immune response, regulating inflammation, autophagy, and mitochondrial function. Its structure and activity make it an important protein for understanding the mechanisms of the innate immune response and its dysregulation in various diseases. With its potential applications in both basic research and clinical settings, Recombinant Human NLRX1 Protein is a valuable tool for studying and potentially targeting NLRX1 in disease.

Recombinant Human NLRX1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NLRX1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products