Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human REEP1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H902
Molecular weight:
25.58 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Asp56–Gly161
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human REEP1 Protein, N-His-SUMO & C-Strep

Product name ARO-P11752-100
Uniprot ID Q9H902
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRG
Molecular weight 25.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp56-Gly161
Aliases /Synonyms Spastic paraplegia 31 protein, Receptor expression-enhancing protein 1, SPG31, C2orf23, REEP1
Reference ARO-P11752
Note For research use only.
Molecular Constructor
Asp56–Gly161
Product name ARO-P11752-1MG
Uniprot ID Q9H902
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRG
Molecular weight 25.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp56-Gly161
Aliases /Synonyms Spastic paraplegia 31 protein, Receptor expression-enhancing protein 1, SPG31, C2orf23, REEP1
Reference ARO-P11752
Note For research use only.
Molecular Constructor
Asp56–Gly161
Product name ARO-P11752-50
Uniprot ID Q9H902
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRG
Molecular weight 25.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp56-Gly161
Aliases /Synonyms Spastic paraplegia 31 protein, Receptor expression-enhancing protein 1, SPG31, C2orf23, REEP1
Reference ARO-P11752
Note For research use only.
Molecular Constructor
Asp56–Gly161

Introduction

Recombinant Human REEP1 Protein, also known as Receptor Expression Enhancing Protein 1, is a protein that plays a crucial role in maintaining the structure and function of the endoplasmic reticulum (ER). It is encoded by the REEP1 gene and is highly conserved among different species, including humans. In this article, we will discuss the structure, activity, and applications of Recombinant Human REEP1 Protein.

Structure of Recombinant Human REEP1 Protein

Recombinant Human REEP1 Protein is a transmembrane protein that consists of 232 amino acids. It has a predicted molecular weight of 26 kDa and contains a highly conserved N-terminal hydrophobic domain, two transmembrane domains, and a C-terminal cytoplasmic domain. The N-terminal domain is responsible for anchoring the protein to the ER membrane, while the C-terminal domain interacts with other proteins involved in ER morphology and function.

Activity of Recombinant Human REEP1 Protein

Recombinant Human REEP1 Protein is primarily involved in maintaining the structure and function of the ER. It has been shown to play a crucial role in regulating the shape and size of the ER by promoting the formation of tubular ER networks. This is achieved through its interaction with other ER shaping proteins, such as reticulons and atlastins.

In addition to its role in ER morphology, Recombinant Human REEP1 Protein also plays a role in lipid metabolism. It has been shown to interact with lipid droplets and regulate their size and distribution within the cell. This suggests that Recombinant Human REEP1 Protein may play a role in lipid homeostasis and potentially contribute to lipid-related diseases.

Application of Recombinant Human REEP1 Protein

Recombinant Human REEP1 Protein has a wide range of applications in both research and therapeutic settings. One of its main applications is in studying the structure and function of the ER. Its role in regulating ER morphology makes it a valuable tool for understanding the mechanisms behind ER-related diseases, such as neurodegenerative disorders and lipid storage diseases.

In addition, Recombinant Human REEP1 Protein has been used in drug discovery and development. As it plays a role in lipid metabolism, it has been identified as a potential target for drug development in diseases such as obesity and diabetes. Recombinant Human REEP1 Protein can also be used as a diagnostic tool for certain diseases, as mutations in the REEP1 gene have been linked to hereditary spastic paraplegia.

Furthermore, Recombinant Human REEP1 Protein has been used in the production of therapeutic antibodies. Its ability to interact with other proteins involved in ER morphology makes it a valuable tool for improving the yield and quality of recombinant proteins produced in mammalian cells. This has significant implications for the production of therapeutic proteins, as it can potentially improve their efficacy and reduce production costs.

Conclusion

In summary, Recombinant Human REEP1 Protein is a crucial protein involved in maintaining the structure and function of the ER. Its interaction with other proteins and lipids makes it a key player in ER morphology and lipid metabolism. Its wide range of applications in research and therapeutics highlights its importance in understanding and treating various diseases. Further studies on Recombinant Human REEP1 Protein may lead to the development of new treatments for ER-related diseases and improve the production of therapeutic proteins.

Recombinant Human REEP1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human REEP1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products