Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SMYD2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRG4
Molecular weight:
51.83 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Met1–His433
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SMYD2 Protein, N-His

Product name ARO-P11742-100
Uniprot ID Q9NRG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Molecular weight 51.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His433
Aliases /Synonyms HSKM-B, N-lysine methyltransferase SMYD2, Histone methyltransferase SMYD2, SMYD2, SET and MYND domain-containing protein 2, Lysine N-methyltransferase 3C, KMT3C
Reference ARO-P11742
Note For research use only.
Molecular Constructor
Met1–His433
Product name ARO-P11742-1MG
Uniprot ID Q9NRG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Molecular weight 51.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His433
Aliases /Synonyms HSKM-B, N-lysine methyltransferase SMYD2, Histone methyltransferase SMYD2, SMYD2, SET and MYND domain-containing protein 2, Lysine N-methyltransferase 3C, KMT3C
Reference ARO-P11742
Note For research use only.
Molecular Constructor
Met1–His433
Product name ARO-P11742-50
Uniprot ID Q9NRG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Molecular weight 51.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His433
Aliases /Synonyms HSKM-B, N-lysine methyltransferase SMYD2, Histone methyltransferase SMYD2, SMYD2, SET and MYND domain-containing protein 2, Lysine N-methyltransferase 3C, KMT3C
Reference ARO-P11742
Note For research use only.
Molecular Constructor
Met1–His433

Introduction

Recombinant proteins have revolutionized the field of biotechnology and have become an essential tool for various research and therapeutic applications. One such protein is the Recombinant Human SMYD2 Protein, which has gained significant attention due to its unique structure and diverse functions. In this article, we will explore the structure, activity, and applications of this protein in detail.

Structure of Recombinant Human SMYD2 Protein

Recombinant Human SMYD2 Protein is a 46 kDa protein that belongs to the SET and MYND domain-containing (SMYD) family. It is composed of 427 amino acids and contains a SET domain, a MYND domain, and a C-terminal domain. The SET domain is responsible for the histone methyltransferase (HMT) activity of SMYD2, while the MYND domain is involved in protein-protein interactions. The C-terminal domain is essential for substrate recognition and binding.

Activity of Recombinant Human SMYD2 Protein

Recombinant Human SMYD2 Protein is a histone methyltransferase that catalyzes the transfer of a methyl group from S-adenosylmethionine (SAM) to lysine 4 of histone H3 (H3K4). This methylation leads to the activation of gene expression by promoting the recruitment of transcriptional co-activators. SMYD2 has also been shown to methylate non-histone proteins, such as p53, estrogen receptor α, and retinoblastoma protein, which regulates their functions. Moreover, SMYD2 has been reported to have protein lysine methyltransferase activity, which targets non-histone proteins, including transcription factors and chromatin-associated proteins.

Applications of Recombinant Human SMYD2 Protein

The unique structure and activity of Recombinant Human SMYD2 Protein make it a valuable tool for various research and therapeutic applications.

Epigenetics Research

As an HMT, SMYD2 plays a crucial role in regulating gene expression through histone methylation. Therefore, it is widely used in epigenetics research to study the impact of histone modifications on gene expression and disease development.

Cancer Research

SMYD2 has been implicated in various types of cancer, including breast, prostate, and lung cancer. Its overexpression has been linked to tumor growth and metastasis. Therefore, Recombinant Human SMYD2 Protein is used in cancer research to study its role in disease progression and as a potential therapeutic target.

Drug Discovery

The dysregulation of SMYD2 has been associated with several diseases, making it a potential target for drug discovery. Recombinant Human SMYD2 Protein is used to screen for small molecule inhibitors that can selectively inhibit its activity and potentially treat diseases associated with SMYD2 dysregulation.

Therapeutic Applications

Due to its role in cancer and other diseases, SMYD2 has emerged as a potential therapeutic target. Recombinant Human SMYD2 Protein can be used to develop targeted therapies that specifically inhibit its activity and potentially treat diseases caused by SMYD2 dysregulation.

Diagnostic Applications

The overexpression of SMYD2 has been observed in certain types of cancer, making it a potential biomarker for disease diagnosis. Recombinant Human SMYD2 Protein can be used to develop diagnostic assays for the detection of SMYD2 levels in patient samples.

Conclusion

Recombinant Human SMYD2 Protein is a versatile protein with a unique structure and diverse functions. Its role in regulating gene expression and its involvement in various diseases make it a valuable tool for research and therapeutic applications. With ongoing research on SMYD2, we can expect to

Recombinant Human SMYD2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SMYD2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products