Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SRSF2/SC-35 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q01130
Molecular weight:
13.85 kDa

Original price was: $347.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Met1–Ser101
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SRSF2/SC-35 Protein, N-His

Product name ARO-P12662-100
Uniprot ID Q01130
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Molecular weight 13.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser101
Aliases /Synonyms Splicing factor SC35, Splicing factor, arginine/serine-rich 2, SC-35, Serine/arginine-rich splicing factor 2, SFRS2, SRSF2, Splicing component, 35 kDa, Protein PR264
Reference ARO-P12662
Note For research use only.
Molecular Constructor
Met1–Ser101
Product name ARO-P12662-1MG
Uniprot ID Q01130
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Molecular weight 13.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser101
Aliases /Synonyms Splicing factor SC35, Splicing factor, arginine/serine-rich 2, SC-35, Serine/arginine-rich splicing factor 2, SFRS2, SRSF2, Splicing component, 35 kDa, Protein PR264
Reference ARO-P12662
Note For research use only.
Molecular Constructor
Met1–Ser101
Product name ARO-P12662-50
Uniprot ID Q01130
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Molecular weight 13.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser101
Aliases /Synonyms Splicing factor SC35, Splicing factor, arginine/serine-rich 2, SC-35, Serine/arginine-rich splicing factor 2, SFRS2, SRSF2, Splicing component, 35 kDa, Protein PR264
Reference ARO-P12662
Note For research use only.
Molecular Constructor
Met1–Ser101

Introduction

Recombinant Human SRSF2/SC-35 Protein, also known as Serine/arginine-rich splicing factor 2 (SRSF2) or SC35, is a protein that plays a crucial role in the process of mRNA splicing. This protein is encoded by the SRSF2 gene and is a member of the serine/arginine-rich (SR) family of proteins. Recombinant Human SRSF2/SC-35 Protein is widely used in research and has potential applications in therapeutics.

Structure of Recombinant Human SRSF2/SC-35 Protein

Recombinant Human SRSF2/SC-35 Protein is a 35 kDa protein with a molecular formula of C162H263N45O49S1. It is composed of 248 amino acids and has a predicted isoelectric point of 8.95. The protein has a modular structure with an N-terminal RNA recognition motif (RRM) and a C-terminal arginine/serine-rich (RS) domain. The RRM domain is responsible for binding to RNA, while the RS domain is involved in protein-protein interactions.

Activity of Recombinant Human SRSF2/SC-35 Protein

Recombinant Human SRSF2/SC-35 Protein is a key regulator of alternative splicing, a process by which different combinations of exons can be included or excluded from the final mRNA transcript. This protein plays a crucial role in the recognition of specific RNA sequences and facilitates the recruitment of other splicing factors to the pre-mRNA. It has been shown to enhance the splicing of specific exons and to regulate alternative splicing in a tissue-specific manner.

In addition to its role in splicing, Recombinant Human SRSF2/SC-35 Protein also has other activities. It has been shown to interact with other proteins involved in RNA processing, such as the RNA helicase p68. This interaction is important for the regulation of RNA stability and translation. Furthermore, Recombinant Human SRSF2/SC-35 Protein has been found to play a role in the regulation of transcription and mRNA export.

Application of Recombinant Human SRSF2/SC-35 Protein

Recombinant Human SRSF2/SC-35 Protein has various applications in research, particularly in the field of RNA splicing and gene expression. It is commonly used in in vitro splicing assays to study the mechanisms of alternative splicing. It can also be used to study the effects of mutations in the SRSF2 gene, which have been linked to diseases such as myelodysplastic syndromes and acute myeloid leukemia.

Furthermore, Recombinant Human SRSF2/SC-35 Protein has potential therapeutic applications. It has been shown to regulate the splicing of Bcl-x, a gene involved in apoptosis, and its overexpression has been linked to drug resistance in cancer cells. Therefore, targeting this protein could potentially be used as a strategy to sensitize cancer cells to chemotherapy.

In addition, Recombinant Human SRSF2/SC-35 Protein has been identified as a potential biomarker for certain diseases. Its expression has been found to be altered in various cancers, including breast, lung, and prostate cancer. Furthermore, mutations in the SRSF2 gene have been linked to hematological malignancies. Therefore, detection of this protein could potentially serve as a diagnostic or prognostic marker for these diseases.

Conclusion

Recombinant Human SRSF2/SC-35 Protein is a crucial protein involved in the process of mRNA splicing. It has a modular structure and plays a role in regulating alternative splicing, as well as other RNA processing events. This protein has various applications in research and has potential therapeutic and diagnostic implications. Further studies on the structure and function of Recombinant Human SRSF2/SC-35 Protein could provide valuable insights into its role in

Recombinant Human SRSF2/SC-35 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SRSF2/SC-35 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products