Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRPC4AP Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TEL6
Molecular weight:
11.93 kDa

Original price was: $367.00.Current price is: $327.00.

100ug 11% OFF + 327 loyalty points
Leu427–Lys511
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRPC4AP Protein, N-His

Product name ARO-P12008-100
Uniprot ID Q8TEL6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK
Molecular weight 11.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu427-Lys511
Aliases /Synonyms Trp4-associated protein, Protein TRUSS, C20orf188, Protein TAP1, Short transient receptor potential channel 4-associated protein, TRRP4AP, TRPC4AP, Trpc4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein
Reference ARO-P12008
Note For research use only.
Molecular Constructor
Leu427–Lys511
Product name ARO-P12008-1MG
Uniprot ID Q8TEL6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK
Molecular weight 11.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu427-Lys511
Aliases /Synonyms Trp4-associated protein, Protein TRUSS, C20orf188, Protein TAP1, Short transient receptor potential channel 4-associated protein, TRRP4AP, TRPC4AP, Trpc4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein
Reference ARO-P12008
Note For research use only.
Molecular Constructor
Leu427–Lys511
Product name ARO-P12008-50
Uniprot ID Q8TEL6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK
Molecular weight 11.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu427-Lys511
Aliases /Synonyms Trp4-associated protein, Protein TRUSS, C20orf188, Protein TAP1, Short transient receptor potential channel 4-associated protein, TRRP4AP, TRPC4AP, Trpc4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein
Reference ARO-P12008
Note For research use only.
Molecular Constructor
Leu427–Lys511

Introduction to Recombinant Human TRPC4AP Protein

Recombinant Human TRPC4AP Protein, also known as Transient Receptor Potential Cation Channel Subfamily C Member 4-Associated Protein, is a protein that plays a crucial role in regulating calcium ion channels in the body. This protein is encoded by the TRPC4AP gene and is a member of the TRPC family of proteins. TRPC4AP is a multi-domain protein that is involved in various cellular processes, including cell signaling, cell growth, and cell differentiation.

Structure of Recombinant Human TRPC4AP Protein

Recombinant Human TRPC4AP Protein is a 105 kDa protein that consists of 921 amino acids. It is composed of several domains, including an N-terminal coiled-coil domain, a central TRPC4 interaction domain, and a C-terminal domain. The coiled-coil domain is responsible for protein-protein interactions, while the TRPC4 interaction domain binds to TRPC4 channels, regulating their activity. The C-terminal domain is involved in regulating the localization and stability of TRPC4AP.

The crystal structure of Recombinant Human TRPC4AP Protein has been determined, revealing the overall shape of the protein and the specific interactions between its domains. This structural information has provided insights into the mechanism of action of TRPC4AP and its role in regulating calcium ion channels.

Activity of Recombinant Human TRPC4AP Protein

Recombinant Human TRPC4AP Protein is a key regulator of TRPC4 channels, which are non-selective cation channels that allow the flow of calcium ions into cells. TRPC4 channels are involved in various cellular processes, including muscle contraction, neuronal signaling, and immune response. TRPC4AP binds to TRPC4 channels and regulates their activity, acting as a negative regulator by decreasing the amount of calcium ions entering the cell.

Studies have shown that Recombinant Human TRPC4AP Protein plays a crucial role in regulating the activity of TRPC4 channels in various tissues and cell types. For example, in smooth muscle cells, TRPC4AP inhibits TRPC4 channels, leading to relaxation of the smooth muscle and vasodilation. In neurons, TRPC4AP modulates the activity of TRPC4 channels, which are involved in synaptic plasticity and learning and memory.

Application of Recombinant Human TRPC4AP Protein

Due to its role in regulating calcium ion channels, Recombinant Human TRPC4AP Protein has potential therapeutic applications in various diseases. For example, TRPC4 channels have been implicated in cardiovascular diseases, such as hypertension and atherosclerosis. As TRPC4AP inhibits TRPC4 channels, it could potentially be used as a treatment for these conditions.

Furthermore, TRPC4AP has also been linked to neurological disorders, such as Alzheimer’s disease and Parkinson’s disease. Studies have shown that TRPC4AP levels are decreased in the brains of patients with Alzheimer’s disease, suggesting that it may play a role in the pathogenesis of this condition. By regulating TRPC4 channels, TRPC4AP could potentially be used as a therapeutic target for these neurodegenerative diseases.

In addition, Recombinant Human TRPC4AP Protein has been used in research studies to investigate the role of TRPC4 channels in various cellular processes. By modulating the activity of TRPC4 channels, TRPC4AP can provide insights into the function of these channels and their potential role in disease processes.

Conclusion

Recombinant Human TRPC4AP Protein is a multi-domain protein that plays a crucial role in regulating TRPC4 channels, which are involved in various cellular processes. Its structure has been determined, and its activity has been extensively studied, revealing its potential as a therapeutic target for various diseases. As research on TRPC

Recombinant Human TRPC4AP Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRPC4AP Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products