Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human UMPS Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P11172
Molecular weight:
30.06 kDa

Original price was: $269.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Ser226–Val480
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human UMPS Protein, N-His

Product name ARO-P11675-100
Uniprot ID P11172
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Molecular weight 30.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser226-Val480
Aliases /Synonyms OMPdecase, OPRT, OPRTase, UMP synthase, ODC, Uridine 5'-monophosphate synthase, UMPS
Reference ARO-P11675
Note For research use only.
Molecular Constructor
Ser226–Val480
Product name ARO-P11675-1MG
Uniprot ID P11172
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Molecular weight 30.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser226-Val480
Aliases /Synonyms OMPdecase, OPRT, OPRTase, UMP synthase, ODC, Uridine 5'-monophosphate synthase, UMPS
Reference ARO-P11675
Note For research use only.
Molecular Constructor
Ser226–Val480
Product name ARO-P11675-50
Uniprot ID P11172
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Molecular weight 30.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser226-Val480
Aliases /Synonyms OMPdecase, OPRT, OPRTase, UMP synthase, ODC, Uridine 5'-monophosphate synthase, UMPS
Reference ARO-P11675
Note For research use only.
Molecular Constructor
Ser226–Val480

Introduction

Recombinant Human UMPS Protein is a type of protein that is produced through genetic engineering techniques. It is a combination of the human uridine monophosphate synthetase (UMPS) gene and a vector, which is usually a plasmid or a virus. This protein is widely used in various fields of research and has many potential applications due to its unique structure and activity.

Structure of Recombinant Human UMPS Protein

The structure of Recombinant Human UMPS Protein is similar to that of the natural human UMPS protein. It is composed of two subunits, or domains, known as orotate phosphoribosyltransferase (OPRT) and orotidine-5′-phosphate decarboxylase (ODCase). These two domains are connected by a flexible linker region.

The OPRT domain is responsible for the first step in the conversion of orotate to uridine monophosphate (UMP), while the ODCase domain is involved in the second step of the process. This two-step process is essential for the synthesis of UMP, which is a precursor for the production of RNA and DNA in the body.

Activity of Recombinant Human UMPS Protein

The main activity of Recombinant Human UMPS Protein is its ability to catalyze the conversion of orotate to UMP. This is an important step in the de novo pyrimidine biosynthesis pathway, which is crucial for the production of nucleotides in the body. In addition to its enzymatic activity, this protein also has other functions such as binding to specific molecules and interacting with other proteins.

Recombinant Human UMPS Protein has been shown to have high enzymatic activity and stability, making it a valuable tool for various research applications. It is also highly specific, meaning it only catalyzes the conversion of orotate to UMP and does not interfere with other biochemical processes in the body.

Applications of Recombinant Human UMPS Protein

Recombinant Human UMPS Protein has a wide range of applications in both academic and industrial settings. Some of the most common applications include:

  • Antigen production: Recombinant Human UMPS Protein can be used as an antigen in immunoassays, such as ELISA, to detect the presence of specific antibodies in a sample. It can also be used as a control in experiments involving antibody-antigen interactions.
  • Drug discovery: The de novo pyrimidine biosynthesis pathway, in which Recombinant Human UMPS Protein plays a crucial role, is a target for many antimicrobial and anticancer drugs. This protein can be used in drug screening assays to identify potential inhibitors or activators of the pathway.
  • Gene therapy: Mutations in the UMPS gene can lead to a rare metabolic disorder called orotic aciduria. Recombinant Human UMPS Protein can be used in gene therapy to replace the defective UMPS gene and restore normal enzyme activity in affected individuals.

Conclusion

In summary, Recombinant Human UMPS Protein is a valuable tool in the field of biotechnology and has many potential applications. Its unique structure and activity make it a versatile protein that can be used in various research settings. As technology continues to advance, the potential uses of this protein will only continue to grow.

Recombinant Human UMPS Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human UMPS Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products