Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Rat SCNN1A/SCNN1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Rat
Uniprot ID:
P37089
Molecular weight:
32.25 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
Glu132–Asp391
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Rat SCNN1A/SCNN1 Protein, N-His

Product name ARO-P12656-100
Uniprot ID P37089
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence EEYLSYPVSLNINLNSDKLVFPAVTVCTLNPYRYTEIKEELEELDRITEQTLFDLYKYNSSYTRQAGARRRSSRDLLGAFPHPLQRLRTPPPPYSGRTARSGSSSVRDNNPQVDRKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLSDTSPALEEEALGNFIFTCRFNQAPCNQANYSKFHHPMYGNCYTFNDKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDD
Molecular weight 32.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu132-Asp391
Aliases /Synonyms Amiloride-sensitive sodium channel subunit alpha; Alpha-NaCH; Epithelial Na(+) channel subunit alpha; Alpha-ENaC; Nonvoltage-gated sodium channel 1 subunit alpha; SCNEA; Scnn1a; Renac
Reference ARO-P12656
Note For research use only.
Molecular Constructor
Glu132–Asp391
Product name ARO-P12656-1MG
Uniprot ID P37089
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence EEYLSYPVSLNINLNSDKLVFPAVTVCTLNPYRYTEIKEELEELDRITEQTLFDLYKYNSSYTRQAGARRRSSRDLLGAFPHPLQRLRTPPPPYSGRTARSGSSSVRDNNPQVDRKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLSDTSPALEEEALGNFIFTCRFNQAPCNQANYSKFHHPMYGNCYTFNDKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDD
Molecular weight 32.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu132-Asp391
Aliases /Synonyms Amiloride-sensitive sodium channel subunit alpha; Alpha-NaCH; Epithelial Na(+) channel subunit alpha; Alpha-ENaC; Nonvoltage-gated sodium channel 1 subunit alpha; SCNEA; Scnn1a; Renac
Reference ARO-P12656
Note For research use only.
Molecular Constructor
Glu132–Asp391
Product name ARO-P12656-50
Uniprot ID P37089
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence EEYLSYPVSLNINLNSDKLVFPAVTVCTLNPYRYTEIKEELEELDRITEQTLFDLYKYNSSYTRQAGARRRSSRDLLGAFPHPLQRLRTPPPPYSGRTARSGSSSVRDNNPQVDRKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLSDTSPALEEEALGNFIFTCRFNQAPCNQANYSKFHHPMYGNCYTFNDKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDD
Molecular weight 32.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu132-Asp391
Aliases /Synonyms Amiloride-sensitive sodium channel subunit alpha; Alpha-NaCH; Epithelial Na(+) channel subunit alpha; Alpha-ENaC; Nonvoltage-gated sodium channel 1 subunit alpha; SCNEA; Scnn1a; Renac
Reference ARO-P12656
Note For research use only.
Molecular Constructor
Glu132–Asp391

Introduction to Recombinant Rat SCNN1A/SCNN1 Protein

Recombinant Rat SCNN1A/SCNN1 Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein is an important component of the epithelial sodium channel (ENaC), which plays a crucial role in maintaining the balance of sodium ions in the body. In this article, we will discuss the structure, activity, and applications of Recombinant Rat SCNN1A/SCNN1 Protein.

Structure of Recombinant Rat SCNN1A/SCNN1 Protein

The Recombinant Rat SCNN1A/SCNN1 Protein is a heteromeric protein complex consisting of three subunits: alpha, beta, and gamma. The alpha subunit is encoded by the SCNN1A gene, while the beta and gamma subunits are encoded by the SCNN1B and SCNN1G genes, respectively. These subunits are arranged in a specific stoichiometry, with two alpha subunits and one each of beta and gamma subunits forming the functional channel.

The alpha subunit is the largest subunit, with a molecular weight of approximately 70 kDa. It contains two transmembrane domains connected by a large extracellular loop. The beta and gamma subunits are smaller, with molecular weights of 55 kDa and 50 kDa, respectively. They also have two transmembrane domains each, but their extracellular loops are shorter compared to the alpha subunit.

Activity of Recombinant Rat SCNN1A/SCNN1 Protein

The main function of Recombinant Rat SCNN1A/SCNN1 Protein is to form a sodium-selective ion channel in the epithelial cells of various tissues, including the kidney, lung, and colon. This channel is responsible for the transport of sodium ions from the lumen of these tissues into the cells, thereby maintaining the sodium balance in the body.

The activity of Recombinant Rat SCNN1A/SCNN1 Protein is regulated by various factors, including hormones, such as aldosterone and vasopressin, and mechanical forces, such as fluid flow and shear stress. These factors can alter the expression and activity of the ENaC channel, thereby affecting the sodium balance in the body.

Applications of Recombinant Rat SCNN1A/SCNN1 Protein

Recombinant Rat SCNN1A/SCNN1 Protein has various applications in both research and clinical settings. In research, this protein is used to study the structure and function of the ENaC channel. It is also used to investigate the role of ENaC in various physiological and pathological conditions, such as hypertension, edema, and cystic fibrosis.

In clinical settings, Recombinant Rat SCNN1A/SCNN1 Protein is used as an antigen in diagnostic tests for certain diseases, such as Liddle syndrome, a rare genetic disorder characterized by excessive sodium reabsorption. This protein can also be used as a therapeutic target for the treatment of diseases associated with dysregulated sodium balance, such as hypertension and congestive heart failure.

Conclusion

Recombinant Rat SCNN1A/SCNN1 Protein is a crucial component of the ENaC channel, which plays a vital role in maintaining the sodium balance in the body. This protein has a specific structure and is regulated by various factors. It has numerous applications in research and clinical settings, making it a valuable tool in understanding and treating diseases associated with sodium imbalance.

In summary, Recombinant Rat SCNN1A/SCNN1 Protein is a highly purified and biologically active protein that has a significant impact on our understanding and treatment of various diseases. Its use in both research and clinical settings highlights its importance as a key player in maintaining the body’s sodium balance.

Recombinant Rat SCNN1A/SCNN1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Rat SCNN1A/SCNN1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products