Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Research Grade Olamkicept

Original price was: $286.00.Current price is: $238.00.

100ug 17% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Research Grade Olamkicept

Product name PX-TA2018-100
Uniprot ID P05231 & P08887
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL6, Anti-Interleukin-6, Anti-IL 6, FE 999301,FE-301,FE-999301,gp130-Fc, CAS: 1702282-14-1
Isotype Fusion - [IL6ST (interleukin 6 signal transducer,
Clonality Polyclonal Antibody
Purification >95% as determined by SDS-PAGE.
Clone Name Olamkicept
Protein Name IL6
Product name PX-TA2018-1MG
Uniprot ID P05231 & P08887
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL6, Anti-Interleukin-6, Anti-IL 6, FE 999301,FE-301,FE-999301,gp130-Fc, CAS: 1702282-14-1
Isotype Fusion - [IL6ST (interleukin 6 signal transducer,
Clonality Polyclonal Antibody
Purification >95% as determined by SDS-PAGE.
Clone Name Olamkicept
Protein Name IL6
Product name PX-TA2018-50
Uniprot ID P05231 & P08887
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL6, Anti-Interleukin-6, Anti-IL 6, FE 999301,FE-301,FE-999301,gp130-Fc, CAS: 1702282-14-1
Isotype Fusion - [IL6ST (interleukin 6 signal transducer,
Clonality Polyclonal Antibody
Purification >95% as determined by SDS-PAGE.
Clone Name Olamkicept
Protein Name IL6

The Structure of Research Grade Olamkicept

Research Grade Olamkicept is a novel antibody that has been developed as a therapeutic target for various diseases. It is a recombinant human monoclonal antibody that has been designed to specifically target and bind to a protein called OX40 ligand (OX40L). The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains, connected by disulfide bonds.

The heavy chains of Olamkicept contain four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH). The light chains, on the other hand, have one constant domain (CL) and one variable domain (VL). The variable domains are responsible for the specificity of the antibody, as they contain the antigen-binding site that recognizes and binds to OX40L.

The Activity of Research Grade Olamkicept

Research Grade Olamkicept has been shown to have potent activity in blocking the interaction between OX40L and its receptor, OX40. OX40L is a member of the tumor necrosis factor (TNF) superfamily and is expressed on the surface of antigen-presenting cells (APCs). When OX40L binds to its receptor on T cells, it activates a signaling pathway that promotes T cell survival and proliferation.

By blocking this interaction, Olamkicept inhibits the activation and proliferation of T cells, which are involved in various autoimmune and inflammatory diseases. It also induces the death of activated T cells, further contributing to its therapeutic effects.

The Application of Research Grade Olamkicept

Research Grade Olamkicept has shown promising results in preclinical studies for the treatment of various diseases, including autoimmune diseases, transplant rejection, and cancer. In autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, Olamkicept has been shown to reduce disease severity and progression by inhibiting the activation of autoreactive T cells.

In transplant rejection, Olamkicept has been shown to prolong graft survival by suppressing the immune response against the transplanted organ. This is particularly important in solid organ transplantation, where the immune system can recognize the transplanted organ as foreign and attack it.

In cancer, Olamkicept has shown potential as an immunotherapy by activating the immune system to recognize and attack cancer cells. It has been shown to enhance the anti-tumor immune response and inhibit the growth and spread of tumors in preclinical models.

The Future of Research Grade Olamkicept

Research Grade Olamkicept is currently undergoing clinical trials for the treatment of various diseases. These trials will provide valuable information on the safety and efficacy of the antibody in humans. If successful, Olamkicept has the potential to become a new treatment option for patients with autoimmune diseases, transplant rejection, and cancer.

In addition, further research on Olamkicept may reveal its potential for the treatment of other diseases, as OX40L is involved in various immune-mediated processes. This could lead to the development of new indications and expand the use of Olamkicept in the clinic.

In summary, Research Grade Olamkicept is a promising antibody with a unique mechanism of action. Its ability to block the interaction between OX40L and its receptor makes it a potential therapeutic target for a wide range of diseases. With ongoing clinical trials and further research, Olamkicept has the potential to improve the lives of patients suffering from various immune-mediated diseases.

SDS-PAGE for Research Grade Olamkicept

SDS-PAGE for Research Grade Olamkicept

Research Grade Olamkicept, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Research Grade Olamkicept”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products