Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Sialic acid-binding Ig-like lectin 15(SIGLEC15)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q6ZMC9

$250.00

50ug + 250 loyalty points
Met1–Thr263 His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Sialic acid-binding Ig-like lectin 15(SIGLEC15)

Sialic acid-binding Ig-like lectin 15(SIGLEC15)

Product name Sialic acid-binding Ig-like lectin 15(SIGLEC15)
Uniprot ID Q6ZMC9
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MEKSIWLLACLAWVLPTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGASTGSHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr263
Aliases /Synonyms Siglec-15,CD33 antigen-like 3,CD33L3
Reference PX-P4693
Note For research use only
Molecular Constructor
Met1–Thr263 His
Product name Sialic acid-binding Ig-like lectin 15(SIGLEC15)
Uniprot ID Q6ZMC9
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MEKSIWLLACLAWVLPTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGASTGSHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr263
Aliases /Synonyms Siglec-15,CD33 antigen-like 3,CD33L3
Reference PX-P4693
Note For research use only
Molecular Constructor
Met1–Thr263 His

There are no reviews yet.

Be the first to review “Sialic acid-binding Ig-like lectin 15(SIGLEC15)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products