Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sotevtamab Biosimilar – Anti-APOJ mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $395.00.Current price is: $308.00.

50ug 22% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Sotevtamab Biosimilar - Anti-APOJ mAb - Research Grade

Product name Sotevtamab Biosimilar - Anti-APOJ mAb - Research Grade
Uniprot ID P10909
Source CAS: 2411526-47-9
Species Humanized
Raw Antigen Sequence MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Sotevtamab,16B5, AB-16B5,APOJ,anti-APOJ
Reference PX-TA1772
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Sotevtamab Biosimilar - Anti-APOJ mAb - Research Grade
Uniprot ID P10909
Source CAS: 2411526-47-9
Species Humanized
Raw Antigen Sequence MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Sotevtamab,16B5, AB-16B5,APOJ,anti-APOJ
Reference PX-TA1772
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1772-50
Uniprot ID P10909
Source CAS: 2411526-47-9
Species Humanized
Raw Antigen Sequence MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sotevtamab,16B5, AB-16B5,APOJ,anti-APOJ
Reference PX-TA1772
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Sotevtamab Biosimilar: A Novel Anti-APOJ Monoclonal Antibody for Therapeutic Targeting

Sotevtamab Biosimilar, also known as Anti-APOJ mAb, is a novel monoclonal antibody that has shown promising results in the treatment of various diseases. This biosimilar is a research grade version of the original Sotevtamab antibody, which is currently in clinical trials for its potential therapeutic applications. In this article, we will delve into the structure, activity, and potential applications of Sotevtamab Biosimilar as an antibody for therapeutic targeting.

Structure of Sotevtamab Biosimilar

Sotevtamab Biosimilar is a monoclonal antibody that is designed to target APOJ (Apolipoprotein J), a protein that is involved in various physiological processes such as lipid metabolism, inflammation, and cell proliferation. The biosimilar is a recombinant protein that is produced in a mammalian cell expression system, and it has a similar structure to the original Sotevtamab antibody. It consists of two heavy chains and two light chains, which are connected by disulfide bonds to form a Y-shaped structure. The variable regions of the antibody, which are responsible for binding to APOJ, are located at the tips of the Y-shaped structure.

Activity of Sotevtamab Biosimilar

Sotevtamab Biosimilar has been shown to have high affinity and specificity towards APOJ. It binds to APOJ with a high binding affinity, which allows it to effectively target and neutralize the protein. This binding also triggers a cascade of immune responses, including antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which can lead to the destruction of APOJ-expressing cells. Additionally, Sotevtamab Biosimilar has been engineered to have an extended half-life, which allows for a longer duration of action and potentially better therapeutic outcomes.

Applications of Sotevtamab Biosimilar

Sotevtamab Biosimilar has shown potential in the treatment of various diseases, particularly those involving APOJ. APOJ has been implicated in the development and progression of several diseases, including cancer, cardiovascular diseases, and neurodegenerative disorders. In preclinical studies, Sotevtamab Biosimilar has demonstrated promising results in inhibiting tumor growth and reducing inflammation in models of cancer and cardiovascular diseases. It has also shown potential in targeting APOJ in the brain, which could have implications for the treatment of neurodegenerative disorders such as Alzheimer’s disease.

Furthermore, Sotevtamab Biosimilar has been shown to have a good safety profile in preclinical studies, with no significant adverse effects observed. This makes it a promising candidate for further development and potential clinical use.

Conclusion

Sotevtamab Biosimilar, a research grade version of the original Sotevtamab antibody, is a novel monoclonal antibody that has shown potential in targeting APOJ for therapeutic purposes. Its structure, activity, and potential applications make it a promising candidate for the treatment of various diseases, particularly those involving APOJ. Further research and clinical trials are needed to fully evaluate the efficacy and safety of this biosimilar, but it holds great promise as a therapeutic antibody for targeting APOJ.

Keywords: Sotevtamab Biosimilar, Anti-APOJ mAb, monoclonal antibody, therapeutic target, APOJ, research grade, structure, activity, applications.

SDS-PAGE for Sotevtamab Biosimilar - Anti-APOJ mAb - Research Grade

SDS-PAGE for Sotevtamab Biosimilar - Anti-APOJ mAb - Research Grade

Sotevtamab Biosimilar - Anti-APOJ mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Sotevtamab Biosimilar - Anti-APOJ mAb - Research Grade

There are no reviews yet.

Be the first to review “Sotevtamab Biosimilar – Anti-APOJ mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products