Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD9 VHH (SAA0905)

Note:
For research use only. Not suitable for human use.

Original price was: $414.00.Current price is: $317.00.

50ug 23% OFF + 317 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD9 VHH (SAA0905)

Product name ARO-A16469-100
Uniprot ID P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Motility-related protein, anti-Leukocyte antigen MIC3, anti-TSPAN29, anti-Cell growth-inhibiting gene 2 protein, anti-CD9, anti-MIC3, anti-p24, anti-Tspan-29, anti-MRP-1, anti-5H9 antigen, anti-Tetraspanin-29, anti-CD9 antigen
Reference ARO-A16469
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD9
Clone Name SAA0905
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16469-1MG
Uniprot ID P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Motility-related protein, anti-Leukocyte antigen MIC3, anti-TSPAN29, anti-Cell growth-inhibiting gene 2 protein, anti-CD9, anti-MIC3, anti-p24, anti-Tspan-29, anti-MRP-1, anti-5H9 antigen, anti-Tetraspanin-29, anti-CD9 antigen
Reference ARO-A16469
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD9
Clone Name SAA0905
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16469-50
Uniprot ID P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Motility-related protein, anti-Leukocyte antigen MIC3, anti-TSPAN29, anti-Cell growth-inhibiting gene 2 protein, anti-CD9, anti-MIC3, anti-p24, anti-Tspan-29, anti-MRP-1, anti-5H9 antigen, anti-Tetraspanin-29, anti-CD9 antigen
Reference ARO-A16469
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD9
Clone Name SAA0905
Target species Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Human CD9 VHH (SAA0905)

SDS-PAGE for Anti-Human CD9 VHH (SAA0905)

Anti-Human CD9 VHH (SAA0905), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CD9 VHH (SAA0905)

There are no reviews yet.

Be the first to review “Anti-Human CD9 VHH (SAA0905)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products