Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597)

  • ARO-A15617-100
  • Validated ELISA

Original price was: $558.00.Current price is: $465.00.

100ug 17% OFF + 465 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597) in ELISA Assay
Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597)

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597)

Product name ARO-A15617-100
Uniprot ID P01852 & P01849
Raw Antigen Sequence EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15617
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TCR αβ/alpha-beta TCR
Clone Name H57-597
Protein Name TCR αβ/alpha-beta TCR
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15617-1MG
Uniprot ID P01852 & P01849
Raw Antigen Sequence EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15617
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TCR αβ/alpha-beta TCR
Clone Name H57-597
Protein Name TCR αβ/alpha-beta TCR
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15617-50
Uniprot ID P01852 & P01849
Raw Antigen Sequence EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15617
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TCR αβ/alpha-beta TCR
Clone Name H57-597
Protein Name TCR αβ/alpha-beta TCR
Target species Anti-Mouse Monoclonal Antibody

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597) in ELISA Assay

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597) in ELISA Assay

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597)

There are no reviews yet.

Be the first to review “Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products