Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Phospho-γ-H2AX (pS139) Antibody (G2)

Original price was: $444.00.Current price is: $324.00.

50ug 27% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Phospho-γ-H2AX (pS139) Antibody (G2)

Product name ARO-A15050-100
Uniprot ID P16104
Raw Antigen Sequence MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15050
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen H2a/x, Histone H2A.X, H2AFX, Histone H2AX, H2AX, gamma H2A.X (phospho S139)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15050-1MG
Uniprot ID P16104
Raw Antigen Sequence MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15050
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen H2a/x, Histone H2A.X, H2AFX, Histone H2AX, H2AX, gamma H2A.X (phospho S139)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15050-50
Uniprot ID P16104
Raw Antigen Sequence MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15050
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen H2a/x, Histone H2A.X, H2AFX, Histone H2AX, H2AX, gamma H2A.X (phospho S139)
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Phospho-γ-H2AX (pS139) Antibody (G2)

SDS-PAGE for Anti-Phospho-γ-H2AX (pS139) Antibody (G2)

Anti-Phospho-γ-H2AX (pS139) Antibody (G2), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Phospho-γ-H2AX (pS139) Antibody (G2)

There are no reviews yet.

Be the first to review “Anti-Phospho-γ-H2AX (pS139) Antibody (G2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products