Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cifurtilimab Biosimilar – Anti-CD40 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade

Product name Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Species Homo Sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Cifurtilimab,,CD40,anti-CD40
Reference PX-TA1825
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Species Homo Sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Cifurtilimab,,CD40,anti-CD40
Reference PX-TA1825
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1825-50
Uniprot ID P25942
Species Homo Sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Cifurtilimab,,CD40,anti-CD40
Reference PX-TA1825
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

The Structure of Cifurtilimab Biosimilar – Anti-CD40 mAb – Research Grade

Cifurtilimab Biosimilar, also known as Anti-CD40 monoclonal antibody (mAb), is a novel therapeutic agent that targets CD40, a protein found on the surface of immune cells. This biosimilar is designed to mimic the structure and function of a previously approved anti-CD40 mAb, making it a promising option for the treatment of various diseases.

The structure of Cifurtilimab Biosimilar is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. Each chain contains variable regions that are responsible for binding to the CD40 protein, and constant regions that determine the effector functions of the antibody.

The Activity of Cifurtilimab Biosimilar

The primary activity of Cifurtilimab Biosimilar is its ability to bind to CD40 and block its interaction with its ligand, CD154. This interaction is crucial for the activation of immune cells, such as B cells, dendritic cells, and macrophages. By inhibiting this interaction, Cifurtilimab Biosimilar can modulate the immune response and potentially treat diseases associated with dysregulated immune function.

In addition, Cifurtilimab Biosimilar can also induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These effector functions are mediated by the constant regions of the antibody and can lead to the destruction of CD40-expressing cells, such as cancer cells.

The Application of Cifurtilimab Biosimilar

Cifurtilimab Biosimilar has shown promising results in preclinical studies for the treatment of various diseases, including cancer, autoimmune disorders, and transplant rejection. In cancer, CD40 is overexpressed on tumor cells and its interaction with CD154 promotes tumor growth and survival. By blocking this interaction, Cifurtilimab Biosimilar can potentially inhibit tumor growth and enhance the anti-tumor immune response.

In autoimmune disorders, CD40 signaling plays a critical role in the development and progression of the disease. Cifurtilimab Biosimilar has the potential to modulate the immune response and reduce inflammation in these conditions.

Furthermore, Cifurtilimab Biosimilar has shown promise in preventing

transplant rejection. CD40 is involved in the activation of immune cells that attack transplanted organs. By blocking this interaction, Cifurtilimab Biosimilar can potentially improve the success rate of organ transplantation.

Conclusion

In summary, Cifurtilimab Biosimilar is a novel therapeutic agent that targets CD40 and has the potential to treat various diseases. Its structure, activity, and application make it a promising option for the treatment of cancer, autoimmune disorders, and transplant rejection. Further clinical studies are needed to fully understand the efficacy and safety of this biosimilar, but it holds great promise in the field of immunotherapy.

SDS-PAGE for Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade

SDS-PAGE for Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade

Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade

There are no reviews yet.

Be the first to review “Cifurtilimab Biosimilar – Anti-CD40 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products