Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Emiltatug Biosimilar – Anti-V-set domain-containing T-cell activation inhibitor 1 mAb – Research Grade

  • PX-TA2189-100
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $302.00.Current price is: $238.00.

100ug 21% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Emiltatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade

Product name PX-TA2189-50
Uniprot ID Q7Z7D3
Source CAS: 2855971-15-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA2189-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Emiltatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade
Uniprot ID Q7Z7D3
Source CAS: 2855971-15-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA2189-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Emiltatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade
Uniprot ID Q7Z7D3
Source CAS: 2855971-15-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA2189-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Emiltatug Biosimilar is a therapeutic antibody that targets the V-set domain-containing T-cell activation inhibitor 1 (VISTA) protein. This monoclonal antibody (mAb) is a research grade product that has shown promising results in pre-clinical studies for the treatment of various diseases. In this article, we will discuss the structure, activity, and potential applications of Emiltatug Biosimilar.

Structure of Emiltatug Biosimilar

Emiltatug Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is produced in CHO cells. It has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains contain four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain two constant domains (CL and CH1) and one variable domain (VL). The variable domains of Emiltatug Biosimilar are responsible for binding to the VISTA protein.

Activity of Emiltatug Biosimilar

VISTA is a cell surface protein that is expressed on various immune cells, including T cells, B cells, and myeloid cells. It is known to act as a negative regulator of immune response, and its overexpression has been linked to the progression of various diseases, including cancer and autoimmune disorders. Emiltatug Biosimilar binds to VISTA and blocks its inhibitory activity, thereby promoting immune response against these diseases.

In pre-clinical studies, Emiltatug Biosimilar has shown potent anti-tumor activity by enhancing the function of T cells and natural killer cells. It has also been shown to inhibit the growth of certain autoimmune cells, making it a potential treatment option for autoimmune diseases.

Potential Applications of Emiltatug Biosimilar

Emiltatug Biosimilar has shown promising results in pre-clinical studies for the treatment of various diseases, including cancer and autoimmune disorders. Its ability to block VISTA’s inhibitory activity makes it a potential therapeutic option for cancers that overexpress VISTA, such as lung cancer, breast cancer, and melanoma. It can also be used in combination with other cancer treatments, such as chemotherapy and immunotherapy, to enhance their efficacy.

In addition to cancer, Emiltatug Biosimilar has also shown potential in the treatment of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. By inhibiting the function of VISTA, it can suppress the overactive immune response that is responsible for these diseases.

Conclusion

Emiltatug Biosimilar is a promising therapeutic antibody that targets the VISTA protein. Its structure, consisting of humanized IgG1, makes it suitable for use in humans. Its activity in blocking VISTA’s inhibitory function has shown potential in the treatment of various diseases, including cancer and autoimmune disorders. As a research grade product, Emiltatug Biosimilar is currently undergoing further studies and has the potential to be developed into a clinically approved therapeutic option in the future.

SDS-PAGE for Emiltatug Biosimilar - Research Grade

SDS-PAGE for Emiltatug Biosimilar - Research Grade

Emiltatug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Emiltatug Biosimilar - Research Grade in ELISA Assay

Emiltatug Biosimilar - Research Grade in ELISA Assay

Emiltatug Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Emiltatug Biosimilar – Anti-V-set domain-containing T-cell activation inhibitor 1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products