Brand: ProteoGenix

Human EGF Recombinant Protein

PX-P3041-10
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: P01133
Molecular weight:: 33.19 kDa

$250.00

+ 250 loyalty points

Partial Yes

size size

50ug $250.00
100ug $392.00
500ug $793.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human EGF Recombinant Protein

Product name	Human EGF Recombinant Protein
Uniprot ID	P01133
Uniprot link	http://www.uniprot.org/uniprot/P01133
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Molecular weight	33.19 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
NCBI Reference	P01133
Aliases /Synonyms	Epidermal Growth Factor proteins, EGF, URG, Beta-Urogastrone, Pro-epidermal Growth Factor proteins
Reference	PX-P3041
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human EGF Recombinant Protein
Uniprot ID	P01133
Uniprot link	http://www.uniprot.org/uniprot/P01133
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Molecular weight	33.19 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
NCBI Reference	P01133
Aliases /Synonyms	Epidermal Growth Factor proteins, EGF, URG, Beta-Urogastrone, Pro-epidermal Growth Factor proteins
Reference	PX-P3041
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human EGF Recombinant Protein
Uniprot ID	P01133
Uniprot link	http://www.uniprot.org/uniprot/P01133
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Molecular weight	33.19 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
NCBI Reference	P01133
Aliases /Synonyms	Epidermal Growth Factor proteins, EGF, URG, Beta-Urogastrone, Pro-epidermal Growth Factor proteins
Reference	PX-P3041
Note	For research use only
Molecular Constructor	Partial Yes

There are no reviews yet.

Be the first to review “Human EGF Recombinant Protein”

Human EGF Recombinant Protein

Human EGF Recombinant Protein

Related products

Bevacizumab Biosimilar – Anti-VEGF mAb – Research Grade

Ranibizumab Biosimilar – Anti-VEGF mAb – Research Grade

Aflibercept Biosimilar – Anti-VEGF mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

EGFR protein – Epidermal growth factor receptor(EGFR)

Mucin-4(MUC4) EGF Like 1 and 2

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human EGF Recombinant Protein

Specifications Human EGF Recombinant Protein

Documents

Reviews

Related products

Bevacizumab Biosimilar – Anti-VEGF mAb – Research Grade

Ranibizumab Biosimilar – Anti-VEGF mAb – Research Grade

Aflibercept Biosimilar – Anti-VEGF mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

Cetuximab Biosimilar – Anti-hEGFR mAb – Research Grade

EGFR protein – Epidermal growth factor receptor(EGFR)

Mucin-4(MUC4) EGF Like 1 and 2

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human EGF Recombinant Protein