Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human Growth hormone 1 isoform 1 recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human Growth hormone 1 isoform 1 recombinant protein |
|---|---|
| Uniprot ID | B1A4G6 |
| Uniprot link | http://www.uniprot.org/uniprot/B1A4G6 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | GPFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
| Molecular weight | 22.24kDa |
| Protein delivered with Tag? | No |
| Purity estimated | 90% |
| Buffer | 50mM Tris-HCl pH 7.0, 150mM NaCl |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Aliases /Synonyms | GH1, Growth hormone B5, HCG1749481, isoform CRA_s, GHB5, hCG_1749481, GH,GH-N,GHB5,GHN,Growth hormone 1,hGH-N,IGHD1B |
| Reference | PX-P4003 |
| Note | For research use only |
Related products
Biosimilar
Dulaglutide Biosimilar – Anti-Glucagon-like peptide-1 receptor agonist mAb – Research Grade
PX-TA1017 238$
Biosimilar
Abatacept Biosimilar – Anti-CTLA-4 extracellular domain linked to IgG1 Fc mAb – Research Grade
PX-TA1020 238$
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.