Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD121a Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P14778
Molecular weight:
64.3KDa

Original price was: $246.00.Current price is: $224.00.

50ug 9% OFF + 224 loyalty points
Met1~Thr332 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD121a Recombinant Protein

Product name PX-P4101-100
Uniprot ID P14778
Uniprot link http://www.uniprot.org/uniprot/P14778
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Molecular weight 64.3KDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Thr332
Protein Accession P14778
Spec:Entrez GeneID 3554
Spec:NCBI Gene Aliases P80; IL1R; IL1RA; CD121A; D2S1473; IL-1R-alpha
Spec:SwissProtID Q587I7
NCBI Reference P14778
Aliases /Synonyms IL1R, IL1RA, IL1RT1
Reference PX-P4101
Note For research use only
Molecular Constructor
Met1~Thr332 Fc
Product name PX-P4101-1MG
Uniprot ID P14778
Uniprot link http://www.uniprot.org/uniprot/P14778
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Molecular weight 64.3KDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Thr332
Protein Accession P14778
Spec:Entrez GeneID 3554
Spec:NCBI Gene Aliases P80; IL1R; IL1RA; CD121A; D2S1473; IL-1R-alpha
Spec:SwissProtID Q587I7
NCBI Reference P14778
Aliases /Synonyms IL1R, IL1RA, IL1RT1
Reference PX-P4101
Note For research use only
Molecular Constructor
Met1~Thr332 Fc
Product name PX-P4101-50
Uniprot ID P14778
Uniprot link http://www.uniprot.org/uniprot/P14778
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Molecular weight 64.3KDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Thr332
Protein Accession P14778
Spec:Entrez GeneID 3554
Spec:NCBI Gene Aliases P80; IL1R; IL1RA; CD121A; D2S1473; IL-1R-alpha
Spec:SwissProtID Q587I7
NCBI Reference P14778
Aliases /Synonyms IL1R, IL1RA, IL1RT1
Reference PX-P4101
Note For research use only
Molecular Constructor
Met1~Thr332 Fc

CD121a Recombinant Protein

There are no reviews yet.

Be the first to review “CD121a Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products