Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Growth hormone 1 isoform 1 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
B1A4G6
Molecular weight:
22.24kDa

Original price was: $290.00.Current price is: $250.00.

50ug 14% OFF + 250 loyalty points
Partial No
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Growth hormone 1 isoform 1 recombinant protein

Product name Human Growth hormone 1 isoform 1 recombinant protein
Uniprot ID B1A4G6
Uniprot link http://www.uniprot.org/uniprot/B1A4G6
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GPFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Molecular weight 22.24kDa
Protein delivered with Tag? No
Purity estimated 90%
Buffer 50mM Tris-HCl pH 7.0, 150mM NaCl
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms GH1, Growth hormone B5, HCG1749481, isoform CRA_s, GHB5, hCG_1749481, GH,GH-N,GHB5,GHN,Growth hormone 1,hGH-N,IGHD1B
Reference PX-P4003
Note For research use only
Molecular Constructor
Partial No
Product name Human Growth hormone 1 isoform 1 recombinant protein
Uniprot ID B1A4G6
Uniprot link http://www.uniprot.org/uniprot/B1A4G6
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GPFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Molecular weight 22.24kDa
Protein delivered with Tag? No
Purity estimated 90%
Buffer 50mM Tris-HCl pH 7.0, 150mM NaCl
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms GH1, Growth hormone B5, HCG1749481, isoform CRA_s, GHB5, hCG_1749481, GH,GH-N,GHB5,GHN,Growth hormone 1,hGH-N,IGHD1B
Reference PX-P4003
Note For research use only
Molecular Constructor
Partial No
Product name PX-P4003-1MG
Uniprot ID B1A4G6
Uniprot link http://www.uniprot.org/uniprot/B1A4G6
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GPFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Molecular weight 22.24kDa
Protein delivered with Tag? No
Purity estimated 90%
Buffer 50mM Tris-HCl pH 7.0, 150mM NaCl
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms GH1, Growth hormone B5, HCG1749481, isoform CRA_s, GHB5, hCG_1749481, GH,GH-N,GHB5,GHN,Growth hormone 1,hGH-N,IGHD1B
Reference PX-P4003
Note For research use only
Molecular Constructor
Partial No

Human Growth hormone 1 isoform 1 recombinant protein

There are no reviews yet.

Be the first to review “Human Growth hormone 1 isoform 1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products