Brand: ProteoGenix

Human Growth hormone 1 isoform 1 recombinant protein

PX-P4003-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: B1A4G6
Molecular weight:: 22.24kDa

$250.00

50ug + 250 loyalty points

Partial No

size size

50ug $250.00
100ug $706.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human Growth hormone 1 isoform 1 recombinant protein

Product name	Human Growth hormone 1 isoform 1 recombinant protein
Uniprot ID	B1A4G6
Uniprot link	http://www.uniprot.org/uniprot/B1A4G6
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	GPFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Molecular weight	22.24kDa
Protein delivered with Tag?	No
Purity estimated	90%
Buffer	50mM Tris-HCl pH 7.0, 150mM NaCl
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Aliases /Synonyms	GH1, Growth hormone B5, HCG1749481, isoform CRA_s, GHB5, hCG_1749481, GH,GH-N,GHB5,GHN,Growth hormone 1,hGH-N,IGHD1B
Reference	PX-P4003
Note	For research use only
Molecular Constructor	Partial No

Product name	Human Growth hormone 1 isoform 1 recombinant protein
Uniprot ID	B1A4G6
Uniprot link	http://www.uniprot.org/uniprot/B1A4G6
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	GPFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Molecular weight	22.24kDa
Protein delivered with Tag?	No
Purity estimated	90%
Buffer	50mM Tris-HCl pH 7.0, 150mM NaCl
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Aliases /Synonyms	GH1, Growth hormone B5, HCG1749481, isoform CRA_s, GHB5, hCG_1749481, GH,GH-N,GHB5,GHN,Growth hormone 1,hGH-N,IGHD1B
Reference	PX-P4003
Note	For research use only
Molecular Constructor	Partial No

There are no reviews yet.

Be the first to review “Human Growth hormone 1 isoform 1 recombinant protein”

Human Growth hormone 1 isoform 1 recombinant protein

Human Growth hormone 1 isoform 1 recombinant protein

Related products

Durvalumab Biosimilar – Anti-PD-L1 mAb – Research Grade

Avelumab Biosimilar – Anti-PD-L1 mAb – Research Grade

Nivolumab Biosimilar – Anti-PD1 mAb – Research Grade

Pembrolizumab Biosimilar – Anti-PD1 mAb – Research Grade

Rituximab Biosimilar – Anti-MS4A1 mAb – Research Grade

Ustekinumab Biosimilar – Anti-Human IL-12 IL-23 mAb – Research Grade

Zolbetuximab Biosimilar – Anti-CLDN18.2 mAb – Research Grade

Dulaglutide Biosimilar – Anti-Glucagon-like peptide-1 receptor agonist mAb – Research Grade

Abatacept Biosimilar – Anti-CTLA-4 extracellular domain linked to IgG1 Fc mAb – Research Grade

Ixekizumab Biosimilar – Anti-IL17A mAb – Research Grade

Romilkimab Biosimilar – Anti-IL13, IL4 mAb – Research Grade

Cilgavimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade

Alemtuzumab Biosimilar – Anti-CD52 mAb – Research Grade

Apolizumab Biosimilar – Anti-HLA-DRB mAb – Research Grade

CD121a Recombinant Protein

DNA repair protein RAD51 homolog 2(Rad51b)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human Growth hormone 1 isoform 1 recombinant protein

Specifications Human Growth hormone 1 isoform 1 recombinant protein

Documents

Reviews

Related products

Durvalumab Biosimilar – Anti-PD-L1 mAb – Research Grade

Avelumab Biosimilar – Anti-PD-L1 mAb – Research Grade

Nivolumab Biosimilar – Anti-PD1 mAb – Research Grade

Pembrolizumab Biosimilar – Anti-PD1 mAb – Research Grade

Rituximab Biosimilar – Anti-MS4A1 mAb – Research Grade

Ustekinumab Biosimilar – Anti-Human IL-12 IL-23 mAb – Research Grade

Zolbetuximab Biosimilar – Anti-CLDN18.2 mAb – Research Grade

Dulaglutide Biosimilar – Anti-Glucagon-like peptide-1 receptor agonist mAb – Research Grade

Abatacept Biosimilar – Anti-CTLA-4 extracellular domain linked to IgG1 Fc mAb – Research Grade

Ixekizumab Biosimilar – Anti-IL17A mAb – Research Grade

Romilkimab Biosimilar – Anti-IL13, IL4 mAb – Research Grade

Cilgavimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade

Alemtuzumab Biosimilar – Anti-CD52 mAb – Research Grade

Apolizumab Biosimilar – Anti-HLA-DRB mAb – Research Grade

CD121a Recombinant Protein

DNA repair protein RAD51 homolog 2(Rad51b)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human Growth hormone 1 isoform 1 recombinant protein