Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)

  • ARO-A13360-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $377.00.Current price is: $305.00.

50ug 19% OFF + 305 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)

Product name ARO-A13360-100
Uniprot ID P01584
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL1B, Interleukin-1 beta, Catabolin, IL1F2, IL-1 beta,IL-1β
Reference ARO-A13360
Clonality Monoclonal Antibody
Protein Name IL1B
Product name ARO-A13360-1MG
Uniprot ID P01584
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL1B, Interleukin-1 beta, Catabolin, IL1F2, IL-1 beta,IL-1β
Reference ARO-A13360
Clonality Monoclonal Antibody
Protein Name IL1B
Product name ARO-A13360-50
Uniprot ID P01584
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL1B, Interleukin-1 beta, Catabolin, IL1F2, IL-1 beta,IL-1β
Reference ARO-A13360
Clonality Monoclonal Antibody
Protein Name IL1B

Flow Cytometry results for InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)

Flow Cytometry results for InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)

Target Cells were stained with an irrelevant antibody or InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)

SDS-PAGE for InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)

InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products