Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rilonacept Biosimilar – Anti-Interleukin-1 beta fusion protein – Research Grade

Uniprot ID:
P01584

Original price was: $228.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Rilonacept Biosimilar - Anti-Interleukin-1 beta fusion protein - Research Grade

Product name Rilonacept Biosimilar - Anti-Interleukin-1 beta fusion protein - Research Grade
Uniprot ID P01584
Expression system XtenCHO
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Interleukin-1 beta, IL1B, Catabolin, IL1F2, IL-1 beta
Reference PX-TA2021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL1RAP (interleukin-1 receptor accessory protein) - IL1R1 (type 1 interleukin-1 receptor, interleukin 1 receptor, type I)]2 - IGHG1 Fc (Fragment constant)
Product name Rilonacept Biosimilar - Anti-Interleukin-1 beta fusion protein - Research Grade
Uniprot ID P01584
Expression system XtenCHO
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Interleukin-1 beta, IL1B, Catabolin, IL1F2, IL-1 beta
Reference PX-TA2021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL1RAP (interleukin-1 receptor accessory protein) - IL1R1 (type 1 interleukin-1 receptor, interleukin 1 receptor, type I)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2021-50
Uniprot ID P01584
Expression system XtenCHO
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Interleukin-1 beta, IL1B, Catabolin, IL1F2, IL-1 beta
Reference PX-TA2021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL1RAP (interleukin-1 receptor accessory protein) - IL1R1 (type 1 interleukin-1 receptor, interleukin 1 receptor, type I)]2 - IGHG1 Fc (Fragment constant)

Rilonacept Biosimilar: A Promising Anti-Interleukin-1 Beta Fusion Protein

Rilonacept Biosimilar, also known as ABP 959, is a novel fusion protein that has shown promising results in the treatment of various inflammatory diseases. This biosimilar is a recombinant version of the human interleukin-1 receptor antagonist (IL-1Ra) fused to the Fc region of human immunoglobulin G1 (IgG1). It acts as a potent inhibitor of interleukin-1 beta (IL-1β), a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various diseases.

Structure of Rilonacept Biosimilar

Rilonacept Biosimilar is a 649 amino acid protein with a molecular weight of approximately 72 kDa. It is composed of two domains, the N-terminal domain of IL-1Ra and the C-terminal domain of IgG1 Fc. The N-terminal domain of IL-1Ra is responsible for binding to IL-1 receptors and inhibiting the downstream signaling pathways, while the C-terminal domain of IgG1 Fc provides stability and prolongs the half-life of the protein in the body.

The crystal structure of Rilonacept Biosimilar has been determined, revealing the three-dimensional arrangement of the two domains. The N-terminal domain of IL-1Ra adopts a beta-trefoil fold, which is similar to the structure of IL-1β. This allows Rilonacept Biosimilar to bind to IL-1 receptors with high affinity and block the binding of IL-1β. The C-terminal domain of IgG1 Fc forms a homodimer, which is essential for the effector functions of the protein.

Activity of Rilonacept Biosimilar

Rilonacept Biosimilar acts as a potent inhibitor of IL-1β by binding to its receptors and preventing its interaction with the cell surface. This leads to the inhibition of downstream signaling pathways, including the activation of nuclear factor-kappa B (NF-κB) and mitogen-activated protein kinases (MAPKs), which are responsible for the production of pro-inflammatory cytokines and chemokines. By blocking the activity of IL-1β, Rilonacept Biosimilar reduces inflammation and provides relief from symptoms associated with various diseases.

In addition to its anti-inflammatory activity, Rilonacept Biosimilar also exhibits immunomodulatory effects. It has been shown to increase the production of anti-inflammatory cytokines, such as IL-10, and decrease the production of pro-inflammatory cytokines, such as IL-6 and tumor necrosis factor-alpha (TNF-α). This balanced modulation of the immune response makes Rilonacept Biosimilar a promising therapeutic agent for the treatment of various autoimmune and inflammatory diseases.

Application of Rilonacept Biosimilar

Rilonacept Biosimilar is currently being evaluated in clinical trials for the treatment of several inflammatory diseases, including rheumatoid arthritis, gout, and cryopyrin-associated periodic syndromes (CAPS). In a phase III clinical trial, Rilonacept Biosimilar demonstrated significant efficacy in reducing disease activity and improving symptoms in patients with rheumatoid arthritis.

Moreover, Rilonacept Biosimilar has also been granted orphan drug designation by the FDA for the treatment of CAPS, a group of rare genetic disorders characterized by recurrent episodes of inflammation. In a phase III clinical trial, Rilonacept Biosimilar showed a rapid and sustained response in patients with CAPS, leading to its approval for this indication.

Conclusion

Rilonacept Biosimilar is a promising anti-IL-1β fusion protein that has shown significant efficacy in the treatment of various inflammatory diseases. Its unique structure and mechanism of action make it a potent inhibitor of IL-1β, with the potential to provide relief from symptoms and improve the quality of life for patients.

Rilonacept Biosimilar - Anti-Interleukin-1 beta fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Rilonacept Biosimilar – Anti-Interleukin-1 beta fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products