Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Lysozyme C(LYZ) |
---|---|
Uniprot ID | P00698 |
Origin species | Gallus gallus (Chicken) |
Expression system | Prokaryotic expression |
Sequence | MGSHHHHHHSGATTYKLGDVDNDTLISAIDLAAVQQHILGKKTLTGEAFKAADVNANGEIEALDLAELKQFLLGRITKFSGEKVFGRCELAAAMKRHGLDNYRGYSLGNWVCVAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMSAWVAWRNRCKGTDVQAWIRGCRL |
Molecular weight | 23.07kda |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >80% by SDS-PAGE |
Buffer | 100mM Tris-HCl, pH8.0, 3.6mM 2-mercaptoethanol, 1.3mM oxidized glutathione ,1mM EDTA |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Lys19-Leu147 |
Aliases /Synonyms | 1,4-beta-N-acetylmuramidase C,Allergen Gal d IV,Allergen: Gal d 4 |
Reference | PX-P4328 |
Note | For research use only |
Related products
Send us a message from the form below
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.