Cart (0 Items)
Your cart is currently empty.
View Products 
               
               
              | Size | 100ug, 50ug | 
|---|---|
| Brand | ProteoGenix | 
| Product type | Recombinant Proteins | 
| Host Species | Escherichia coli (E. coli) | 
| Applications | Elisa, WB | 
| Product name | Lysozyme C(LYZ) | 
|---|---|
| Uniprot ID | P00698 | 
| Origin species | Gallus gallus (Chicken) | 
| Expression system | Prokaryotic expression | 
| Sequence | MGSHHHHHHSGATTYKLGDVDNDTLISAIDLAAVQQHILGKKTLTGEAFKAADVNANGEIEALDLAELKQFLLGRITKFSGEKVFGRCELAAAMKRHGLDNYRGYSLGNWVCVAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMSAWVAWRNRCKGTDVQAWIRGCRL | 
| Molecular weight | 23.07kda | 
| Protein delivered with Tag? | N-terminal His Tag | 
| Purity estimated | >80% by SDS-PAGE | 
| Buffer | 100mM Tris-HCl, pH8.0, 3.6mM 2-mercaptoethanol, 1.3mM oxidized glutathione ,1mM EDTA | 
| Delivery condition | Dry Ice | 
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days | 
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) | 
| Brand | ProteoGenix | 
| Host species | Escherichia coli (E.coli) | 
| Fragment Type | Lys19-Leu147 | 
| Aliases /Synonyms | 1,4-beta-N-acetylmuramidase C,Allergen Gal d IV,Allergen: Gal d 4 | 
| Reference | PX-P4328 | 
| Note | For research use only | 
Related products
Send us a message from the form below
Reviews
There are no reviews yet.