Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lysozyme C(LYZ)

Host species:
Escherichia coli (E.coli)
Origin species:
Gallus gallus (Chicken)
Uniprot ID:
P00698
Molecular weight:
23.07kda

$217.00

50ug + 217 loyalty points
His Lys19–Leu147
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Lysozyme C(LYZ)

Product name Lysozyme C(LYZ)
Uniprot ID P00698
Origin species Gallus gallus (Chicken)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGATTYKLGDVDNDTLISAIDLAAVQQHILGKKTLTGEAFKAADVNANGEIEALDLAELKQFLLGRITKFSGEKVFGRCELAAAMKRHGLDNYRGYSLGNWVCVAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMSAWVAWRNRCKGTDVQAWIRGCRL
Molecular weight 23.07kda
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer 100mM Tris-HCl, pH8.0, 3.6mM 2-mercaptoethanol, 1.3mM oxidized glutathione ,1mM EDTA
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys19-Leu147
Aliases /Synonyms 1,4-beta-N-acetylmuramidase C,Allergen Gal d IV,Allergen: Gal d 4
Reference PX-P4328
Note For research use only
Molecular Constructor
His Lys19–Leu147
Product name Lysozyme C(LYZ)
Uniprot ID P00698
Origin species Gallus gallus (Chicken)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGATTYKLGDVDNDTLISAIDLAAVQQHILGKKTLTGEAFKAADVNANGEIEALDLAELKQFLLGRITKFSGEKVFGRCELAAAMKRHGLDNYRGYSLGNWVCVAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMSAWVAWRNRCKGTDVQAWIRGCRL
Molecular weight 23.07kda
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer 100mM Tris-HCl, pH8.0, 3.6mM 2-mercaptoethanol, 1.3mM oxidized glutathione ,1mM EDTA
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys19-Leu147
Aliases /Synonyms 1,4-beta-N-acetylmuramidase C,Allergen Gal d IV,Allergen: Gal d 4
Reference PX-P4328
Note For research use only
Molecular Constructor
His Lys19–Leu147

There are no reviews yet.

Be the first to review “Lysozyme C(LYZ)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products