Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Monocyte differentiation antigen CD14（CD14）

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P08571

$250.00

+ 250 loyalty points
Met1–Ala83 His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Monocyte differentiation antigen CD14（CD14）

Monocyte differentiation antigen CD14（CD14）

Product name Monocyte differentiation antigen CD14（CD14）
Uniprot ID P08571
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYAGSHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala83
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein,CD14
Reference PX-P4644
Note For research use only
Molecular Constructor
Met1–Ala83 His
Product name Monocyte differentiation antigen CD14（CD14）
Uniprot ID P08571
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYAGSHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala83
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein,CD14
Reference PX-P4644
Note For research use only
Molecular Constructor
Met1–Ala83 His

There are no reviews yet.

Be the first to review “Monocyte differentiation antigen CD14（CD14）”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products