Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AKAP3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75969
Molecular weight:
16.21 kDa

Original price was: $287.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Ala726–Leu853
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AKAP3 Protein, N-His

Product name ARO-P11619-100
Uniprot ID O75969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQNKQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNVTPLQLLDWLMVNL
Molecular weight 16.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala726-Leu853
Aliases /Synonyms Fibrousheathin I, AKAP110, CT82, Fibrous sheath protein of 95 kDa, FSP95, Fibrousheathin-1, A-kinase anchor protein 110 kDa, AKAP3, Protein kinase A-anchoring protein 3, Cancer/testis antigen 82, AKAP 110, AKAP-3, Sperm oocyte-binding protein, SOB1, A-kinase anchor protein 3, PRKA3
Reference ARO-P11619
Note For research use only.
Molecular Constructor
Ala726–Leu853
Product name ARO-P11619-1MG
Uniprot ID O75969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQNKQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNVTPLQLLDWLMVNL
Molecular weight 16.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala726-Leu853
Aliases /Synonyms Fibrousheathin I, AKAP110, CT82, Fibrous sheath protein of 95 kDa, FSP95, Fibrousheathin-1, A-kinase anchor protein 110 kDa, AKAP3, Protein kinase A-anchoring protein 3, Cancer/testis antigen 82, AKAP 110, AKAP-3, Sperm oocyte-binding protein, SOB1, A-kinase anchor protein 3, PRKA3
Reference ARO-P11619
Note For research use only.
Molecular Constructor
Ala726–Leu853
Product name ARO-P11619-50
Uniprot ID O75969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQNKQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNVTPLQLLDWLMVNL
Molecular weight 16.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala726-Leu853
Aliases /Synonyms Fibrousheathin I, AKAP110, CT82, Fibrous sheath protein of 95 kDa, FSP95, Fibrousheathin-1, A-kinase anchor protein 110 kDa, AKAP3, Protein kinase A-anchoring protein 3, Cancer/testis antigen 82, AKAP 110, AKAP-3, Sperm oocyte-binding protein, SOB1, A-kinase anchor protein 3, PRKA3
Reference ARO-P11619
Note For research use only.
Molecular Constructor
Ala726–Leu853

Introduction

Recombinant Human AKAP3 Protein, also known as A-kinase anchor protein 3, is a protein that plays a crucial role in the regulation of protein kinase A (PKA) signaling. It is a member of the A-kinase anchor protein family, which acts as a scaffold protein to localize PKA to specific subcellular compartments. AKAP3 is involved in various cellular processes, including cell signaling, cell growth, and differentiation. In this article, we will discuss the structure, activity, and application of Recombinant Human AKAP3 Protein.

Structure of Recombinant Human AKAP3 Protein

Recombinant Human AKAP3 Protein is a 120 kDa protein that is encoded by the AKAP3 gene located on chromosome X. It contains a conserved N-terminal domain, a central domain, and a C-terminal domain. The N-terminal domain of AKAP3 binds to the regulatory subunit of PKA, while the central domain binds to the catalytic subunit of PKA. The C-terminal domain of AKAP3 interacts with other signaling proteins, such as phosphodiesterases and phosphatases.

Activity of Recombinant Human AKAP3 Protein

The main function of Recombinant Human AKAP3 Protein is to regulate the activity of PKA by anchoring it to specific subcellular compartments. PKA is a serine/threonine kinase that plays a crucial role in various cellular processes, including metabolism, gene expression, and cell cycle progression. By localizing PKA to specific sites within the cell, AKAP3 ensures that PKA is only activated in response to specific stimuli, thus preventing unnecessary activation.

In addition to PKA regulation, AKAP3 has also been shown to play a role in sperm motility. It is highly expressed in the testis and is a major component of the fibrous sheath of spermatozoa. AKAP3 interacts with multiple proteins involved in sperm motility, such as dynein, and is essential for the proper function of the sperm tail. Therefore, Recombinant Human AKAP3 Protein can be used to study the mechanisms of sperm motility and potentially develop treatments for male infertility.

Application of Recombinant Human AKAP3 Protein

Recombinant Human AKAP3 Protein has various applications in both research and clinical settings. In research, it can be used as a tool to study the regulation of PKA signaling and its role in different cellular processes. It can also be used to investigate the mechanisms of sperm motility and male infertility. Recombinant Human AKAP3 Protein can be produced in large quantities and is readily available, making it a valuable tool for researchers.

In the clinical setting, Recombinant Human AKAP3 Protein has potential applications in the treatment of diseases related to PKA dysregulation. For example, PKA signaling has been implicated in various cancers, and AKAP3 has been shown to interact with proteins involved in cancer progression. By targeting AKAP3, it may be possible to modulate PKA activity and potentially develop new treatments for cancer.

Conclusion

Recombinant Human AKAP3 Protein is a crucial protein involved in the regulation of PKA signaling and sperm motility. Its structure, activity, and various applications make it a valuable tool for researchers studying cellular processes and potential treatments for diseases related to PKA dysregulation. With further research and development, Recombinant Human AKAP3 Protein has the potential to contribute to advancements in both basic science and clinical medicine.

Recombinant Human AKAP3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AKAP3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products