Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human LOX, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P28300
Molecular weight:
31.34 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
His Asp169–Tyr417
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human LOX, N-His

Product name ARO-P13714-100
Uniprot ID P28300
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Molecular weight 31.34 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp169-Tyr417
Aliases /Synonyms Lysyl oxidase, LOX, Protein-lysine 6-oxidase
Reference ARO-P13714
Note For research use only.
Molecular Constructor
His Asp169–Tyr417
Product name ARO-P13714-1MG
Uniprot ID P28300
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Molecular weight 31.34 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp169-Tyr417
Aliases /Synonyms Lysyl oxidase, LOX, Protein-lysine 6-oxidase
Reference ARO-P13714
Note For research use only.
Molecular Constructor
His Asp169–Tyr417
Product name ARO-P13714-50
Uniprot ID P28300
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Molecular weight 31.34 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp169-Tyr417
Aliases /Synonyms Lysyl oxidase, LOX, Protein-lysine 6-oxidase
Reference ARO-P13714
Note For research use only.
Molecular Constructor
His Asp169–Tyr417

Introduction

Recombinant Human LOX (lysyl oxidase) is a type of enzyme that plays a crucial role in the formation and maintenance of extracellular matrix (ECM) in various tissues. This enzyme is produced through recombinant DNA technology, which involves the manipulation of genetic material to produce desired proteins. Recombinant Human LOX has gained significant attention in the scientific community due to its potential applications in various fields, including tissue engineering, drug development, and biomaterials research.

Structure of Recombinant Human LOX

Recombinant Human LOX is a 50 kDa protein that belongs to the family of copper-dependent amine oxidases. It is composed of four domains: a signal peptide, a propeptide, a catalytic domain, and a C-terminal domain. The signal peptide is responsible for the secretion of LOX from the cells, while the propeptide is essential for the correct folding and activation of the enzyme. The catalytic domain contains the active site of LOX, which is responsible for the oxidation of lysine and hydroxylysine residues in collagen and elastin. The C-terminal domain is involved in the binding of LOX to ECM proteins, such as fibronectin and collagen.

Activity of Recombinant Human LOX

The main function of LOX is to catalyze the oxidative deamination of lysine and hydroxylysine residues in ECM proteins, leading to the formation of aldehydes. These aldehydes then undergo spontaneous reactions, resulting in the formation of crosslinks between collagen and elastin fibers. This process is crucial for the stability and strength of the ECM, which is essential for maintaining the structural integrity of tissues. Additionally, LOX has been found to play a role in the regulation of cell proliferation, migration, and differentiation, making it a key player in tissue development and repair.

Application of Recombinant Human LOX

Recombinant Human LOX has various potential applications in the fields of tissue engineering, drug development, and biomaterials research. Some of these applications include:

Tissue Engineering

LOX has been shown to play a critical role in the formation of collagen and elastin fibers, which are essential components of the ECM in tissues. Therefore, recombinant Human LOX has been investigated as a potential biomolecule for tissue engineering applications. It has been used to enhance the mechanical properties and stability of tissue-engineered constructs, such as skin, cartilage, and bone. Additionally, LOX has been shown to promote the differentiation of stem cells into tissue-specific cells, making it a promising tool for tissue regeneration.

Drug Development

Abnormal levels of LOX have been linked to various diseases, such as fibrosis, cancer, and cardiovascular diseases. Therefore, recombinant Human LOX has been studied as a potential therapeutic target for these conditions. Inhibitors of LOX have been developed and tested for their ability to prevent the formation of crosslinks in ECM proteins, which could potentially slow down the progression of fibrosis and cancer. Additionally, LOX inhibitors have shown potential in reducing the stiffness of atherosclerotic plaques, making them a potential treatment for cardiovascular diseases.

Biomaterials Research

Recombinant Human LOX has also been investigated for its potential use in the development of biomaterials. The crosslinking ability of LOX has been utilized to enhance the mechanical properties of biomaterials, such as hydrogels and scaffolds. These materials can then be used for tissue engineering or drug delivery applications. Additionally, LOX has been used to modify the surface of biomaterials, improving their biocompatibility and promoting cell adhesion.

Conclusion

Recombinant Human LOX is a promising biomolecule with various potential applications in tissue engineering, drug development, and biomaterials research. Its unique structure and activity make it a valuable tool for enhancing the mechanical properties of tissues, regulating cell behavior, and developing

Recombinant Human LOX, N-His

There are no reviews yet.

Be the first to review “Recombinant Human LOX, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products