Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RHBDL2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NX52
Molecular weight:
36.35 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Ala2–Pro71
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RHBDL2 Protein, N-GST & C-His

Product name ARO-P10667-100
Uniprot ID Q9NX52
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPP
Molecular weight 36.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Pro71
Aliases /Synonyms CTF, NTF, RRP2, Rhomboid-related protein 2, Rhomboid-like protein 2, RHBDL2
Reference ARO-P10667
Note For research use only.
Molecular Constructor
Ala2–Pro71
Product name ARO-P10667-1MG
Uniprot ID Q9NX52
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPP
Molecular weight 36.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Pro71
Aliases /Synonyms CTF, NTF, RRP2, Rhomboid-related protein 2, Rhomboid-like protein 2, RHBDL2
Reference ARO-P10667
Note For research use only.
Molecular Constructor
Ala2–Pro71
Product name ARO-P10667-50
Uniprot ID Q9NX52
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPP
Molecular weight 36.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Pro71
Aliases /Synonyms CTF, NTF, RRP2, Rhomboid-related protein 2, Rhomboid-like protein 2, RHBDL2
Reference ARO-P10667
Note For research use only.
Molecular Constructor
Ala2–Pro71

Introduction

Recombinant Human RHBDL2 Protein, also known as Rhomboid-like protein 2, is a type I transmembrane protein that plays a crucial role in various biological processes, including cell signaling, protein trafficking, and cell adhesion. This protein is encoded by the RHBDL2 gene and is highly conserved in vertebrates, indicating its importance in cellular function.

Structure of Recombinant Human RHBDL2 Protein

The recombinant form of RHBDL2 protein is produced through genetic engineering techniques, where the gene that encodes for the protein is inserted into a suitable expression system, such as bacteria or yeast. The resulting protein is a 26 kDa single-pass transmembrane protein with a predicted N-terminal cytoplasmic domain and a C-terminal extracellular domain. The extracellular domain contains a highly conserved catalytic serine residue, which is essential for its proteolytic activity.

Activity of Recombinant Human RHBDL2 Protein

RHBDL2 protein belongs to the rhomboid family of intramembrane serine proteases, which are known for their ability to cleave transmembrane proteins within the lipid bilayer. This proteolytic activity is crucial for the regulation of various signaling pathways, including the Notch and EGF pathways. RHBDL2 has been shown to cleave several transmembrane proteins, such as E-cadherin, CD44, and amyloid precursor protein (APP), and is involved in the regulation of cell adhesion, migration, and APP processing.

Application of Recombinant Human RHBDL2 Protein

Due to its important role in cellular processes, recombinant RHBDL2 protein has been widely used in various research studies and has potential applications in the pharmaceutical industry. Some of the key applications of this protein are discussed below.

1. Study of cellular signaling pathways

Recombinant RHBDL2 protein has been instrumental in understanding the role of the rhomboid family of proteases in various cellular signaling pathways. Its ability to cleave transmembrane proteins within the lipid bilayer has provided valuable insights into the regulation of these pathways and their impact on cellular processes.

2. Development of therapeutic agents

The involvement of RHBDL2 in various signaling pathways and its potential as a drug target has led to the development of therapeutic agents that can modulate its activity. These agents can be used to treat diseases associated with dysregulated signaling pathways, such as cancer and Alzheimer’s disease.

3. Production of monoclonal antibodies

Recombinant RHBDL2 protein has also been used in the production of monoclonal antibodies for research and diagnostic purposes. These antibodies can specifically bind to RHBDL2 and can be used to study its expression and activity in different tissues and cell types.

4. Development of biosensors

The proteolytic activity of RHBDL2 can be utilized in the development of biosensors for the detection of various biomarkers. These biosensors can be used for early diagnosis and monitoring of diseases, providing a non-invasive and sensitive approach.

5. Role in protein production and trafficking

RHBDL2 has been shown to play a role in the trafficking and processing of transmembrane proteins, making it a potential tool for the production of recombinant proteins. Its ability to cleave transmembrane proteins within the lipid bilayer can be harnessed to improve the production and purification of membrane proteins.

Conclusion

In summary, recombinant Human RHBDL2 Protein is a crucial player in various cellular processes, and its production through genetic engineering techniques has opened up new avenues for research and applications in the pharmaceutical industry. Its diverse roles in cellular signaling, protein processing, and trafficking make it a promising target for the development of therapeutic agents and diagnostic tools. Further studies on the structure and function of this protein will provide

Recombinant Human RHBDL2 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human RHBDL2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products