Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CRISP2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P16563
Molecular weight:
27.35 kDa

Original price was: $255.00.Current price is: $230.00.

50ug 10% OFF + 230 loyalty points
Lys23–His243
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CRISP2 Protein, N-His

Product name ARO-P10952-100
Uniprot ID P16563
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KDPDFTSLLTNQLQVQREIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCGENLYMSTDPTLWSTVIQSWYNENEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGNNVMKKSTPYQQGTPCASCPNNCENGLCTNSCDFEDLLSNCESLKTSAGCKHELLKTKCQATCLCEDKIH
Molecular weight 27.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-His243
Aliases /Synonyms Tpx-1, CRISP-2, Cysteine-rich secretory protein 2, Crisp2, Testis-specific protein TPX-1, Tpx1
Reference ARO-P10952
Note For research use only.
Molecular Constructor
Lys23–His243
Product name ARO-P10952-1MG
Uniprot ID P16563
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KDPDFTSLLTNQLQVQREIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCGENLYMSTDPTLWSTVIQSWYNENEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGNNVMKKSTPYQQGTPCASCPNNCENGLCTNSCDFEDLLSNCESLKTSAGCKHELLKTKCQATCLCEDKIH
Molecular weight 27.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-His243
Aliases /Synonyms Tpx-1, CRISP-2, Cysteine-rich secretory protein 2, Crisp2, Testis-specific protein TPX-1, Tpx1
Reference ARO-P10952
Note For research use only.
Molecular Constructor
Lys23–His243
Product name ARO-P10952-50
Uniprot ID P16563
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KDPDFTSLLTNQLQVQREIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCGENLYMSTDPTLWSTVIQSWYNENEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGNNVMKKSTPYQQGTPCASCPNNCENGLCTNSCDFEDLLSNCESLKTSAGCKHELLKTKCQATCLCEDKIH
Molecular weight 27.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-His243
Aliases /Synonyms Tpx-1, CRISP-2, Cysteine-rich secretory protein 2, Crisp2, Testis-specific protein TPX-1, Tpx1
Reference ARO-P10952
Note For research use only.
Molecular Constructor
Lys23–His243

Introduction

Recombinant Mouse CRISP2 Protein, also known as cysteine-rich secretory protein 2, is a protein that is encoded by the CRISP2 gene in mice. This protein belongs to the CRISP family, which is a group of proteins that are characterized by their high cysteine content and their ability to bind to phospholipids. Recombinant CRISP2 protein is produced through genetic engineering techniques and has a wide range of applications in the field of biotechnology and medicine.

Structure of Recombinant Mouse CRISP2 Protein

The recombinant form of CRISP2 protein is a single polypeptide chain that consists of 247 amino acids. It has a molecular weight of approximately 28 kDa. The protein has a high cysteine content, with 16 cysteine residues forming disulfide bonds that contribute to its stable structure. The protein also contains a signal peptide at its N-terminus, which is important for its secretion from cells. The structure of CRISP2 protein is similar to other members of the CRISP family, with a conserved cysteine-rich domain and a variable region that is responsible for its specific functions.

Activity of Recombinant Mouse CRISP2 Protein

Recombinant CRISP2 protein has been shown to have multiple activities, including binding to phospholipids, inhibiting ion channels, and modulating immune responses. The high cysteine content of the protein allows it to interact with phospholipids, which are essential components of cell membranes. This interaction can affect the fluidity and permeability of the membrane, leading to changes in cell function. Additionally, CRISP2 protein has been found to inhibit certain ion channels, which are important for the regulation of cellular processes such as muscle contraction and neurotransmitter release. The protein has also been shown to have immunomodulatory effects, with studies demonstrating its ability to regulate the activity of immune cells and cytokine production.

Application of Recombinant Mouse CRISP2 Protein

The unique properties of recombinant CRISP2 protein make it a valuable tool for various applications in biotechnology and medicine. One major application is its use as an antigen in research and diagnostic assays. The protein can be used to generate antibodies that specifically recognize CRISP2, allowing for the detection and quantification of the protein in various samples. This is particularly useful in studies involving male reproductive function, as CRISP2 is highly expressed in the testes and is involved in sperm maturation and fertilization.

Recombinant CRISP2 protein has also shown potential in the development of novel therapeutics. Its ability to interact with cell membranes and modulate immune responses makes it a promising candidate for drug delivery systems and immunotherapies. Additionally, the protein’s inhibitory effects on ion channels could be harnessed for the treatment of conditions such as hypertension and epilepsy.

Furthermore, recombinant CRISP2 protein has been studied for its potential role in male contraception. The protein is essential for sperm maturation and fertilization, and targeting its function could lead to the development of non-hormonal male contraceptives.

Conclusion

Recombinant Mouse CRISP2 Protein is a unique and versatile protein with multiple activities and applications. Its high cysteine content and ability to interact with phospholipids make it a valuable tool for research and diagnostic assays. The protein’s potential in drug development and male contraception further highlights its importance in the field of biotechnology and medicine. With ongoing research and advancements in genetic engineering techniques, the potential of recombinant CRISP2 protein is yet to be fully explored and could lead to further breakthroughs in various fields.

Recombinant Mouse CRISP2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CRISP2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products