Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Roconkibart Biosimilar – Anti-CTLA-8 mAb – Research Grade

  • PX-TA2137-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Roconkibart Biosimilar - Anti-CTLA-8 mAb - Research Grade

Product name PX-TA2137-50
Uniprot ID Q16552
Source CAS: 2638480-59-6
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2137
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Roconkibart Biosimilar - Anti-CTLA-8 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2638480-59-6
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2137
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Roconkibart Biosimilar - Anti-CTLA-8 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2638480-59-6
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2137
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Roconkibart Biosimilar – Anti-CTLA-8 mAb – Research Grade is a novel monoclonal antibody (mAb) that has been developed as a biosimilar to the existing anti-CTLA-8 mAb. This biosimilar is designed to target the same therapeutic target as the original antibody, but with improved structure and activity. In this article, we will provide a scientific description of Roconkibart Biosimilar, including its structure, activity, and potential applications.

Structure of Roconkibart Biosimilar

Roconkibart Biosimilar is a recombinant humanized mAb, which means that it is produced in a laboratory using genetic engineering techniques. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the mAb are responsible for binding to the target molecule, while the constant regions provide stability and effector functions.

The structure of Roconkibart Biosimilar has been optimized to enhance its binding affinity and specificity towards the therapeutic target, CTLA-8. This has been achieved through the use of advanced protein engineering techniques, such as site-directed mutagenesis and affinity maturation. As a result, Roconkibart Biosimilar has a higher binding affinity and a longer half-life compared to the original anti-CTLA-8 mAb.

Activity of Roconkibart Biosimilar

The primary activity of Roconkibart Biosimilar is to inhibit the activity of CTLA-8, a protein that plays a crucial role in regulating the immune response. CTLA-8 is a negative regulator of T-cell activation, and its inhibition leads to the activation and proliferation of T-cells, which are essential for fighting against cancer and other diseases.

Roconkibart Biosimilar binds to CTLA-8 with high affinity and blocks its interaction with its ligands, CD80 and CD86. This results in the activation of T-cells and the production of cytokines, such as interleukin-2 and interferon-gamma, which are important for the immune response against cancer cells. Additionally, Roconkibart Biosimilar can also induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which further enhance its therapeutic activity.

Applications of Roconkibart Biosimilar

Roconkibart Biosimilar has potential applications in the treatment of various types of cancer, including melanoma, lung cancer, and renal cell carcinoma. As a biosimilar to the original anti-CTLA-8 mAb, it is expected to have similar efficacy and safety profiles. However, due to its improved structure and activity, Roconkibart Biosimilar may offer better therapeutic outcomes and fewer side effects compared to the original antibody.

In addition to its use as a monotherapy, Roconkibart Biosimilar can also be used in combination with other cancer therapies, such as chemotherapy and immune checkpoint inhibitors. This combination approach has shown promising results in preclinical studies, and clinical trials are currently underway to evaluate its efficacy in cancer patients.

Conclusion

Roconkibart Biosimilar – Anti-CTLA-8 mAb – Research Grade is a novel monoclonal antibody that has been developed as a biosimilar to the existing anti-CTLA-8 mAb. It has a well-optimized structure and enhanced activity, making it a promising candidate for the treatment of various types of cancer. Further studies and clinical trials are needed to fully evaluate the potential of this biosimilar in the field of cancer therapy.

Research Grade Roconkibart in ELISA Assay

Research Grade Roconkibart in ELISA Assay

Research Grade Roconkibart can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Roconkibart

SDS-PAGE for Research Grade Roconkibart

Research Grade Roconkibart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Roconkibart Biosimilar - Anti-CTLA-8 mAb - Research Grade

There are no reviews yet.

Be the first to review “Roconkibart Biosimilar – Anti-CTLA-8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products