Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Aldafermin Biosimilar – Anti-FGF19 – Research Grade

Note:
For research use only. Not suitable for human use.

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Aldafermin Biosimilar - Anti-FGF19 - Research Grade

Product name PX-TA2304-100
Uniprot ID O95750
Expression system Mammalian
Raw Antigen Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-FGF19, NGM282
Reference PX-TA2304
Note For research use only. Not suitable for human use.
Isotype Recombinant human FGF19 analogs.
Purification >95% as determined by SDS-PAGE.
Protein Name FGF19
Product name PX-TA2304-1MG
Uniprot ID O95750
Expression system Mammalian
Raw Antigen Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-FGF19, NGM282
Reference PX-TA2304
Note For research use only. Not suitable for human use.
Isotype Recombinant human FGF19 analogs.
Purification >95% as determined by SDS-PAGE.
Protein Name FGF19
Product name PX-TA2304-50
Uniprot ID O95750
Expression system Mammalian
Raw Antigen Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-FGF19, NGM282
Reference PX-TA2304
Note For research use only. Not suitable for human use.
Isotype Recombinant human FGF19 analogs.
Purification >95% as determined by SDS-PAGE.
Protein Name FGF19

The Structure and Function of Aldafermin Biosimilar – Anti-FGF19 – Research Grade Aldafermin Biosimilar – Anti-FGF19 – Research Grade is a therapeutic antibody that targets the fibroblast growth factor 19 (FGF19) protein. This biosimilar is designed to mimic the structure and function of the original antibody, making it a highly effective and safe treatment option for various diseases.

Structure of Aldafermin Biosimilar

Aldafermin Biosimilar is a monoclonal antibody, meaning it is derived from a single type of immune cell. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains contain the antigen-binding sites, while the light chains help stabilize the structure of the antibody.

The structure of Aldafermin Biosimilar is carefully designed to specifically bind to the FGF19 protein. The antigen-binding sites on the heavy chains are highly specific and complementary to the FGF19 protein, allowing for a strong and precise interaction.

Function of Aldafermin Biosimilar

The main function of Aldafermin Biosimilar is to block the activity of FGF19. FGF19 is a protein that plays a crucial role in regulating bile acid and lipid metabolism in the liver. However, in certain diseases, such as non-alcoholic fatty liver disease (NAFLD) and non-alcoholic steatohepatitis (NASH), FGF19 can become overactive and contribute to the progression of these diseases.

By binding to FGF19, Aldafermin Biosimilar prevents it from interacting with its receptors and exerting its effects on the liver. This helps to restore balance in the bile acid and lipid metabolism, leading to improved liver function and potentially slowing down the progression of NAFLD and NASH.

Application of Aldafermin Biosimilar

Aldafermin Biosimilar has shown promising results in preclinical studies for the treatment of NAFLD and NASH. It has also been investigated as a potential treatment for other diseases, such as type 2 diabetes and obesity, as FGF19 plays a role in these conditions as well.

Additionally, Aldafermin Biosimilar has potential applications in the field of oncology. FGF19 has been found to be overexpressed in certain types of cancer, and blocking its activity with Aldafermin Biosimilar could potentially inhibit tumor growth and progression.

Furthermore, the biosimilar nature of Aldafermin Biosimilar makes it a cost-effective treatment option compared to the original antibody. This makes it more accessible to patients who may benefit from its therapeutic effects.

Conclusion

Aldafermin Biosimilar – Anti-FGF19 – Research Grade is a highly specialized and effective therapeutic antibody that targets the FGF19 protein. Its carefully designed structure allows for specific and strong binding to FGF19, leading to the inhibition of its activity. This biosimilar has potential applications in the treatment of NAFLD, NASH, and other diseases related to FGF19 overactivity. Its biosimilar nature also makes it a cost-effective treatment option, making it more accessible to patients. With ongoing research and clinical trials, Aldafermin Biosimilar has the potential to improve the lives of patients with various diseases.

There are no reviews yet.

Be the first to review “Aldafermin Biosimilar – Anti-FGF19 – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products