Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Alpha-amylase inhibitor 0.19

Host species:
Insect
Uniprot ID:
P01085
Molecular weight:
16.25kDa

$250.00

50ug + 250 loyalty points
Ser1–Ala124
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Alpha-amylase inhibitor 0.19

Alpha-amylase inhibitor 0.19

Product name Alpha-amylase inhibitor 0.19
Uniprot ID P01085
Uniprot link https://www.uniprot.org/uniprot/P01085
Expression system Eukaryotic expression
Sequence MKMIILVVSLHVLRNSAASGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDAGSHHHHHH
Molecular weight 16.25kDa
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser1-Ala124
Aliases /Synonyms 0.19 alpha-AI,0.19 AI,Allergen: Tri a 28
Reference PX-P4285
Note For research use only
Molecular Constructor
Ser1–Ala124
Product name Alpha-amylase inhibitor 0.19
Uniprot ID P01085
Uniprot link https://www.uniprot.org/uniprot/P01085
Expression system Eukaryotic expression
Sequence MKMIILVVSLHVLRNSAASGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDAGSHHHHHH
Molecular weight 16.25kDa
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser1-Ala124
Aliases /Synonyms 0.19 alpha-AI,0.19 AI,Allergen: Tri a 28
Reference PX-P4285
Note For research use only
Molecular Constructor
Ser1–Ala124

There are no reviews yet.

Be the first to review “Alpha-amylase inhibitor 0.19”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products