Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-hIgG Fc Antibody (1A043)

Original price was: $338.00.Current price is: $258.00.

50ug 24% OFF + 258 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-hIgG Fc Antibody (1A043)

Product name PTX19434-100
Uniprot ID P01857
Raw Antigen Sequence ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA
Buffer 0.01M PBS, pH 7.4, containing 0.05% proclin 300, 50% glycerol.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at +4°C short term (1-2 weeks).Store at -20 °C 12 months. Store at -80°C long term
Brand ProteoGenix
Host species Mouse
Reference PTX19434
Isotype IgG
Clonality Monoclonal Antibody
Immunogen IgG Fc Fragment
Clone Name 1A043
Product name PTX19434-1MG
Uniprot ID P01857
Raw Antigen Sequence ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA
Buffer 0.01M PBS, pH 7.4, containing 0.05% proclin 300, 50% glycerol.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at +4°C short term (1-2 weeks).Store at -20 °C 12 months. Store at -80°C long term
Brand ProteoGenix
Host species Mouse
Reference PTX19434
Isotype IgG
Clonality Monoclonal Antibody
Immunogen IgG Fc Fragment
Clone Name 1A043
Product name PTX19434-50
Uniprot ID P01857
Raw Antigen Sequence ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA
Buffer 0.01M PBS, pH 7.4, containing 0.05% proclin 300, 50% glycerol.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at +4°C short term (1-2 weeks).Store at -20 °C 12 months. Store at -80°C long term
Brand ProteoGenix
Host species Mouse
Reference PTX19434
Isotype IgG
Clonality Monoclonal Antibody
Immunogen IgG Fc Fragment
Clone Name 1A043

Anti-hIgG Fc Antibody (1A043)

There are no reviews yet.

Be the first to review “Anti-hIgG Fc Antibody (1A043)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products