Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human ATF4/CREB2 Antibody (SAA0818)

  • ARO-A14680-100
  • Validated WB

Original price was: $637.00.Current price is: $462.00.

100ug 27% OFF + 462 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Human ATF4/CREB2 Antibody (SAA0818)
Anti-Human ATF4/CREB2 Antibody (SAA0818) binds to Recombinant Human ATF4 Protein, N-His in WB Assay
Anti-Human ATF4/CREB2 Antibody (SAA0818)

Anti-Human ATF4/CREB2 Antibody (SAA0818)

Product name ARO-A14680-100
Uniprot ID P18848
Raw Antigen Sequence MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14680
Isotype IgG2a
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen TaxREB67, ATF4, cAMP-dependent transcription factor ATF-4, TXREB, CREB2, cAMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, Activating transcription factor 4, CREB-2, Cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14680-1MG
Uniprot ID P18848
Raw Antigen Sequence MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14680
Isotype IgG2a
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen TaxREB67, ATF4, cAMP-dependent transcription factor ATF-4, TXREB, CREB2, cAMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, Activating transcription factor 4, CREB-2, Cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14680-50
Uniprot ID P18848
Raw Antigen Sequence MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14680
Isotype IgG2a
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen TaxREB67, ATF4, cAMP-dependent transcription factor ATF-4, TXREB, CREB2, cAMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, Activating transcription factor 4, CREB-2, Cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human ATF4/CREB2 Antibody (SAA0818)

SDS-PAGE for Anti-Human ATF4/CREB2 Antibody (SAA0818)

Anti-Human ATF4/CREB2 Antibody (SAA0818), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human ATF4/CREB2 Antibody (SAA0818) binds to Recombinant Human ATF4 Protein, N-His in WB Assay

Anti-Human ATF4/CREB2 Antibody (SAA0818) binds to Recombinant Human ATF4 Protein, N-His in WB Assay

Recombinant Human ATF4 Protein, N-His(cat. No.ARO-P15545) can bind Anti-Human ATF4/CREB2 Antibody (SAA0818) in Western Blot Assay as detected on gel analysis.

Anti-Human ATF4/CREB2 Antibody (SAA0818)

There are no reviews yet.

Be the first to review “Anti-Human ATF4/CREB2 Antibody (SAA0818)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products