Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD326/EPCAM VHH (SAA1341)

Note:
For research use only. Not suitable for human use.

Original price was: $588.00.Current price is: $452.00.

100ug 23% OFF + 452 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD326/EPCAM VHH (SAA1341)

Product name ARO-A16451-100
Uniprot ID P16422
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Aliases /Synonyms anti-Epithelial glycoprotein 314, anti-hEGP314, anti-Major gastrointestinal tumor-associated protein GA733-2, anti-EGP314, anti-TACSTD1, anti-Adenocarcinoma-associated antigen, anti-TROP1, anti-EPCAM, anti-Epithelial glycoprotein, anti-KS 1/4 antigen, anti-Tumor-associated calcium signal transducer 1, anti-M4S1, anti-CD326, anti-Ep-CAM, anti-EGP, anti-Epithelial cell adhesion molecule, anti-M1S2, anti-KSA, anti-Cell surface glycoprotein Trop-1, anti-GA733-2, anti-Epithelial cell surface antigen, anti-MIC18
Reference ARO-A16451
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD326/EPCAM
Clone Name SAA1341
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16451-1MG
Uniprot ID P16422
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Aliases /Synonyms anti-Epithelial glycoprotein 314, anti-hEGP314, anti-Major gastrointestinal tumor-associated protein GA733-2, anti-EGP314, anti-TACSTD1, anti-Adenocarcinoma-associated antigen, anti-TROP1, anti-EPCAM, anti-Epithelial glycoprotein, anti-KS 1/4 antigen, anti-Tumor-associated calcium signal transducer 1, anti-M4S1, anti-CD326, anti-Ep-CAM, anti-EGP, anti-Epithelial cell adhesion molecule, anti-M1S2, anti-KSA, anti-Cell surface glycoprotein Trop-1, anti-GA733-2, anti-Epithelial cell surface antigen, anti-MIC18
Reference ARO-A16451
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD326/EPCAM
Clone Name SAA1341
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16451-50
Uniprot ID P16422
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Aliases /Synonyms anti-Epithelial glycoprotein 314, anti-hEGP314, anti-Major gastrointestinal tumor-associated protein GA733-2, anti-EGP314, anti-TACSTD1, anti-Adenocarcinoma-associated antigen, anti-TROP1, anti-EPCAM, anti-Epithelial glycoprotein, anti-KS 1/4 antigen, anti-Tumor-associated calcium signal transducer 1, anti-M4S1, anti-CD326, anti-Ep-CAM, anti-EGP, anti-Epithelial cell adhesion molecule, anti-M1S2, anti-KSA, anti-Cell surface glycoprotein Trop-1, anti-GA733-2, anti-Epithelial cell surface antigen, anti-MIC18
Reference ARO-A16451
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD326/EPCAM
Clone Name SAA1341
Target species Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Human CD326/EPCAM VHH (SAA1341)

SDS-PAGE for Anti-Human CD326/EPCAM VHH (SAA1341)

Anti-Human CD326/EPCAM VHH (SAA1341), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CD326/EPCAM VHH (SAA1341)

There are no reviews yet.

Be the first to review “Anti-Human CD326/EPCAM VHH (SAA1341)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products