Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD63/LAMP3 Antibody (SAA1394)

  • ARO-A15446-100
  • Validated FC

Original price was: $614.00.Current price is: $462.00.

100ug 25% OFF + 462 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD63/LAMP3 Antibody (SAA1394)

Product name ARO-A15446-100
Uniprot ID P08962
Raw Antigen Sequence MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15446
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD63/LAMP3
Clone Name SAA1394
Protein Name CD63/LAMP3
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15446-1MG
Uniprot ID P08962
Raw Antigen Sequence MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15446
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD63/LAMP3
Clone Name SAA1394
Protein Name CD63/LAMP3
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15446-50
Uniprot ID P08962
Raw Antigen Sequence MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15446
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD63/LAMP3
Clone Name SAA1394
Protein Name CD63/LAMP3
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Anti-Human CD63/LAMP3 Antibody (SAA1394)

Flow Cytometry results for Anti-Human CD63/LAMP3 Antibody (SAA1394)

Target Cells were stained with an irrelevant antibody or Anti-Human CD63/LAMP3 Antibody (SAA1394) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Anti-Human CD63/LAMP3 Antibody (SAA1394)

Flow Cytometry results for Anti-Human CD63/LAMP3 Antibody (SAA1394)

Target Cells were stained with an irrelevant antibody or Anti-Human CD63/LAMP3 Antibody (SAA1394) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human CD63/LAMP3 Antibody (SAA1394)

There are no reviews yet.

Be the first to review “Anti-Human CD63/LAMP3 Antibody (SAA1394)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products