Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CEBPD Polyclonal Antibody

  • ARO-A11658-100
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $274.00.Current price is: $201.00.

100ug 27% OFF + 201 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CEBPD Polyclonal Antibody

Product name ARO-A11658-100
Uniprot ID P49716
Raw Antigen Sequence AMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFK
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-NF-IL6-beta, CEBPD, Nuclear factor NF-IL6-beta, CCAAT/enhancer-binding protein delta, C/EBP delta
Reference ARO-A11658
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human CEBPD (Ala51-Lys252).
Product name ARO-A11658-1MG
Uniprot ID P49716
Raw Antigen Sequence AMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFK
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-NF-IL6-beta, CEBPD, Nuclear factor NF-IL6-beta, CCAAT/enhancer-binding protein delta, C/EBP delta
Reference ARO-A11658
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human CEBPD (Ala51-Lys252).
Product name ARO-A11658-50
Uniprot ID P49716
Raw Antigen Sequence AMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFK
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-NF-IL6-beta, CEBPD, Nuclear factor NF-IL6-beta, CCAAT/enhancer-binding protein delta, C/EBP delta
Reference ARO-A11658
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human CEBPD (Ala51-Lys252).

Anti-Human CEBPD Polyclonal Antibody binds to CEBPD, N-His, recombinant protein in WB Assay

Anti-Human CEBPD Polyclonal Antibody binds to CEBPD, N-His, recombinant protein in WB Assay

CEBPD, N-His, recombinant protein(cat. No.PX-P5640) can bind Anti-Human CEBPD Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Human CEBPD Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products