Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CLDN6 Antibody (SAA1412)

  • ARO-A15373-50
  • Validated FC

Original price was: $411.00.Current price is: $324.00.

50ug 21% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CLDN6 Antibody (SAA1412)

Product name ARO-A15373-100
Uniprot ID P56747
Raw Antigen Sequence MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15373
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CLDN6
Clone Name SAA1412
Protein Name CLDN6
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15373-1MG
Uniprot ID P56747
Raw Antigen Sequence MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15373
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CLDN6
Clone Name SAA1412
Protein Name CLDN6
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15373-50
Uniprot ID P56747
Raw Antigen Sequence MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15373
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CLDN6
Clone Name SAA1412
Protein Name CLDN6
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Anti-Human CLDN6 Antibody (SAA1412)

Flow Cytometry results for Anti-Human CLDN6 Antibody (SAA1412)

Flow-cytometry using anti-human CLDN6 antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an anti-human CLDN6 monoclonal antibody (Catalog: ARO-A15373) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Anti-Human CLDN6 Antibody (SAA1412)

Flow Cytometry results for Anti-Human CLDN6 Antibody (SAA1412)

Flow-cytometry using anti-human CLDN6 antibody.CLDN6 Transfected HI5 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human CLDN6 antibody monoclonal antibody (Catalog # ARO-A15373 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human CLDN6 Antibody (SAA1412)

There are no reviews yet.

Be the first to review “Anti-Human CLDN6 Antibody (SAA1412)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products