Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CXCL11/I-TAC Antibody (SAA0466), APC

Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
VHH-mFc
Target species:
Human
Clone Name:
SAA0466

Original price was: $713.00.Current price is: $528.00.

100ug 26% OFF + 528 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CXCL11/I-TAC Antibody (SAA0466), APC

Product name ARO-A10490-100
Uniprot ID O14625
Raw Antigen Sequence MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IP-9, I-TAC, C-X-C motif chemokine 11, ITAC, Small-inducible cytokine B11, SCYB11, Beta-R1, Interferon gamma-inducible protein 9, H174, SCYB9B, CXCL11, Interferon-inducible T-cell alpha chemoattractant
Reference ARO-A10490
Note For research use only.
Isotype VHH-mFc
Clonality Monoclonal Antibody
Target IP-9, I-TAC, C-X-C motif chemokine 11, ITAC, Small-inducible cytokine B11, SCYB11, Beta-R1, Interferon gamma-inducible protein 9, H174, SCYB9B, CXCL11, Interferon-inducible T-cell alpha chemoattractant
Clone Name SAA0466
Target species Human
Product name ARO-A10490-1MG
Uniprot ID O14625
Raw Antigen Sequence MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IP-9, I-TAC, C-X-C motif chemokine 11, ITAC, Small-inducible cytokine B11, SCYB11, Beta-R1, Interferon gamma-inducible protein 9, H174, SCYB9B, CXCL11, Interferon-inducible T-cell alpha chemoattractant
Reference ARO-A10490
Note For research use only.
Isotype VHH-mFc
Clonality Monoclonal Antibody
Target IP-9, I-TAC, C-X-C motif chemokine 11, ITAC, Small-inducible cytokine B11, SCYB11, Beta-R1, Interferon gamma-inducible protein 9, H174, SCYB9B, CXCL11, Interferon-inducible T-cell alpha chemoattractant
Clone Name SAA0466
Target species Human
Product name ARO-A10490-50
Uniprot ID O14625
Raw Antigen Sequence MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IP-9, I-TAC, C-X-C motif chemokine 11, ITAC, Small-inducible cytokine B11, SCYB11, Beta-R1, Interferon gamma-inducible protein 9, H174, SCYB9B, CXCL11, Interferon-inducible T-cell alpha chemoattractant
Reference ARO-A10490
Note For research use only.
Isotype VHH-mFc
Clonality Monoclonal Antibody
Target IP-9, I-TAC, C-X-C motif chemokine 11, ITAC, Small-inducible cytokine B11, SCYB11, Beta-R1, Interferon gamma-inducible protein 9, H174, SCYB9B, CXCL11, Interferon-inducible T-cell alpha chemoattractant
Clone Name SAA0466
Target species Human

There are no reviews yet.

Be the first to review “Anti-Human CXCL11/I-TAC Antibody (SAA0466), APC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products