Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CXCL4/ PF4/Antibody (SAA0463), FITC

Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG2a, kappa
Clone Name:
SAA0463

Original price was: $530.00.Current price is: $405.00.

100ug 24% OFF + 405 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CXCL4/ PF4/Antibody (SAA0463), FITC

Product name ARO-A10888-100
Uniprot ID P02776
Raw Antigen Sequence MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-C-X-C motif chemokine 4, PF-4, Oncostatin-A, Endothelial cell growth inhibitor, CXCL4, Iroplact, Platelet factor 4, PF4, SCYB4
Reference ARO-A10888
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target C-X-C motif chemokine 4, PF-4, Oncostatin-A, Endothelial cell growth inhibitor, CXCL4, Iroplact, Platelet factor 4, PF4, SCYB4
Clone Name SAA0463
Product name ARO-A10888-1MG
Uniprot ID P02776
Raw Antigen Sequence MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-C-X-C motif chemokine 4, PF-4, Oncostatin-A, Endothelial cell growth inhibitor, CXCL4, Iroplact, Platelet factor 4, PF4, SCYB4
Reference ARO-A10888
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target C-X-C motif chemokine 4, PF-4, Oncostatin-A, Endothelial cell growth inhibitor, CXCL4, Iroplact, Platelet factor 4, PF4, SCYB4
Clone Name SAA0463
Product name ARO-A10888-50
Uniprot ID P02776
Raw Antigen Sequence MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-C-X-C motif chemokine 4, PF-4, Oncostatin-A, Endothelial cell growth inhibitor, CXCL4, Iroplact, Platelet factor 4, PF4, SCYB4
Reference ARO-A10888
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target C-X-C motif chemokine 4, PF-4, Oncostatin-A, Endothelial cell growth inhibitor, CXCL4, Iroplact, Platelet factor 4, PF4, SCYB4
Clone Name SAA0463

There are no reviews yet.

Be the first to review “Anti-Human CXCL4/ PF4/Antibody (SAA0463), FITC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products