Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CXCR7/ACKR3 VHH (SAA0795)

Note:
For research use only. Not suitable for human use.

Original price was: $405.00.Current price is: $317.00.

50ug 22% OFF + 317 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CXCR7/ACKR3 VHH (SAA0795)

Product name ARO-A16531-100
Uniprot ID P25106
Raw Antigen Sequence MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CXCR-7, anti-RDC1, anti-C-X-C chemokine receptor type 7, anti-RDC-1, anti-Chemokine orphan receptor 1, anti-G-protein coupled receptor 159, anti-Atypical chemokine receptor 3, anti-CMKOR1, anti-CXCR7, anti-GPR159, anti-G-protein coupled receptor RDC1 homolog, anti-ACKR3, anti-CXC-R7
Reference ARO-A16531
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CXCR7/ACKR3
Clone Name SAA0795
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16531-1MG
Uniprot ID P25106
Raw Antigen Sequence MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CXCR-7, anti-RDC1, anti-C-X-C chemokine receptor type 7, anti-RDC-1, anti-Chemokine orphan receptor 1, anti-G-protein coupled receptor 159, anti-Atypical chemokine receptor 3, anti-CMKOR1, anti-CXCR7, anti-GPR159, anti-G-protein coupled receptor RDC1 homolog, anti-ACKR3, anti-CXC-R7
Reference ARO-A16531
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CXCR7/ACKR3
Clone Name SAA0795
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16531-50
Uniprot ID P25106
Raw Antigen Sequence MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CXCR-7, anti-RDC1, anti-C-X-C chemokine receptor type 7, anti-RDC-1, anti-Chemokine orphan receptor 1, anti-G-protein coupled receptor 159, anti-Atypical chemokine receptor 3, anti-CMKOR1, anti-CXCR7, anti-GPR159, anti-G-protein coupled receptor RDC1 homolog, anti-ACKR3, anti-CXC-R7
Reference ARO-A16531
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CXCR7/ACKR3
Clone Name SAA0795
Target species Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Human CXCR7/ACKR3 VHH (SAA0795)

SDS-PAGE for Anti-Human CXCR7/ACKR3 VHH (SAA0795)

Anti-Human CXCR7/ACKR3 VHH (SAA0795), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CXCR7/ACKR3 VHH (SAA0795)

There are no reviews yet.

Be the first to review “Anti-Human CXCR7/ACKR3 VHH (SAA0795)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products