Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human GZMB Antibody (SAA0516)

Original price was: $395.00.Current price is: $324.00.

50ug 18% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human GZMB Antibody (SAA0516)

Product name ARO-A14878-100
Uniprot ID P10144
Raw Antigen Sequence MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14878
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Cathepsin G-like 1, Granzyme-2, GZMB, Fragmentin-2, Human lymphocyte protein, HLP, CTLA-1, CGL1, CTSGL1, CSPB, Lymphocyte protease, T-cell serine protease 1-3E, Granzyme B,Granzyme-B, CTLA1, GRB, C11, Cytotoxic T-lymphocyte proteinase 2, SECT
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14878-1MG
Uniprot ID P10144
Raw Antigen Sequence MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14878
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Cathepsin G-like 1, Granzyme-2, GZMB, Fragmentin-2, Human lymphocyte protein, HLP, CTLA-1, CGL1, CTSGL1, CSPB, Lymphocyte protease, T-cell serine protease 1-3E, Granzyme B,Granzyme-B, CTLA1, GRB, C11, Cytotoxic T-lymphocyte proteinase 2, SECT
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14878-50
Uniprot ID P10144
Raw Antigen Sequence MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14878
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Cathepsin G-like 1, Granzyme-2, GZMB, Fragmentin-2, Human lymphocyte protein, HLP, CTLA-1, CGL1, CTSGL1, CSPB, Lymphocyte protease, T-cell serine protease 1-3E, Granzyme B,Granzyme-B, CTLA1, GRB, C11, Cytotoxic T-lymphocyte proteinase 2, SECT
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human GZMB Antibody (SAA0516)

SDS-PAGE for Anti-Human GZMB Antibody (SAA0516)

Anti-Human GZMB Antibody (SAA0516), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human GZMB Antibody (SAA0516)

There are no reviews yet.

Be the first to review “Anti-Human GZMB Antibody (SAA0516)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products