Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human IL25/IL17E Monoclonal Antibody (ABM109)

  • PTX25396-100
  • Validated ELISA
Clonality:
Monoclonal Antibody
Host species:
Human
Isotype:
IgG1, kappa

Original price was: $632.00.Current price is: $451.00.

100ug 29% OFF + 451 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human IL25/IL17E Monoclonal Antibody (ABM109) binds to IL25 / IL17E, N-His, recombinant protein in ELISA Assay
SDS-PAGE for Anti-Human IL25/IL17E Monoclonal Antibody (ABM109)

Anti-Human IL25/IL17E Monoclonal Antibody (ABM109)

Product name PTX25396-100
Uniprot ID Q9H293
Raw Antigen Sequence MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL25, Anti-IL17E, Anti-IL-25
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name IL25
Product name PTX25396-1MG
Uniprot ID Q9H293
Raw Antigen Sequence MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL25, Anti-IL17E, Anti-IL-25
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name IL25
Product name PTX25396-50
Uniprot ID Q9H293
Raw Antigen Sequence MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL25, Anti-IL17E, Anti-IL-25
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name IL25

Anti-Human IL25/IL17E Monoclonal Antibody (ABM109) binds to IL25 / IL17E, N-His, recombinant protein in ELISA Assay

Anti-Human IL25/IL17E Monoclonal Antibody (ABM109) binds to IL25 / IL17E, N-His, recombinant protein in ELISA Assay

IL25 / IL17E, N-His, recombinant protein(cat. No.PX-P5786) at 0.5µg/mL (100µL/well) can bind Anti-Human IL25/IL17E Monoclonal Antibody (ABM109) in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Anti-Human IL25/IL17E Monoclonal Antibody (ABM109)

SDS-PAGE for Anti-Human IL25/IL17E Monoclonal Antibody (ABM109)

Anti-Human IL25/IL17E Monoclonal Antibody (ABM109), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Human IL25/IL17E Monoclonal Antibody (ABM109)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products