Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human KLK5 Antibody (SAA0868)

  • ARO-A14658-50
  • Validated ELISA WB

Original price was: $437.00.Current price is: $324.00.

50ug 26% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human KLK5 Antibody (SAA0868)

Product name ARO-A14658-100
Uniprot ID Q9Y337
Raw Antigen Sequence MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14658
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen KLK5, Stratum corneum tryptic enzyme, SCTE, Kallikrein-like protein 2, Kallikrein-5, KLK-L2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14658-1MG
Uniprot ID Q9Y337
Raw Antigen Sequence MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14658
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen KLK5, Stratum corneum tryptic enzyme, SCTE, Kallikrein-like protein 2, Kallikrein-5, KLK-L2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14658-50
Uniprot ID Q9Y337
Raw Antigen Sequence MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14658
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen KLK5, Stratum corneum tryptic enzyme, SCTE, Kallikrein-like protein 2, Kallikrein-5, KLK-L2
Target species Anti-Human Monoclonal Antibody

Anti-Human KLK5 Antibody (SAA0868) binds to Recombinant Mouse KLK5 Protein, N-His in WB Assay

Anti-Human KLK5 Antibody (SAA0868) binds to Recombinant Mouse KLK5 Protein, N-His in WB Assay

Recombinant Mouse KLK5 Protein, N-His(cat. No.ARO-P10473) can bind Anti-Human KLK5 Antibody (SAA0868) in Western Blot Assay as detected on gel analysis.

Anti-Human KLK5 Antibody (SAA0868) binds to Recombinant Mouse KLK5 Protein, N-His in ELISA Assay

Anti-Human KLK5 Antibody (SAA0868) binds to Recombinant Mouse KLK5 Protein, N-His in ELISA Assay

Recombinant Mouse KLK5 Protein, N-His(cat. No.ARO-P10473) at 0.5µg/mL (100µL/well) can bind Anti-Human KLK5 Antibody (SAA0868) in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Human KLK5 Antibody (SAA0868)

There are no reviews yet.

Be the first to review “Anti-Human KLK5 Antibody (SAA0868)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products