Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human LMO2 VHH (SAA0919)

Note:
For research use only. Not suitable for human use.

Original price was: $424.00.Current price is: $317.00.

50ug 25% OFF + 317 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human LMO2 VHH (SAA0919)

Product name ARO-A16441-100
Uniprot ID P25791
Raw Antigen Sequence MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-RBTNL1, anti-Rhombotin-2, anti-T-cell translocation protein 2, anti-LMO-2, anti-Cysteine-rich protein TTG-2, anti-TTG2, anti-LIM domain only protein 2, anti-LMO2, anti-RHOM2, anti-RBTN2
Reference ARO-A16441
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen LMO2
Clone Name SAA0919
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16441-1MG
Uniprot ID P25791
Raw Antigen Sequence MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-RBTNL1, anti-Rhombotin-2, anti-T-cell translocation protein 2, anti-LMO-2, anti-Cysteine-rich protein TTG-2, anti-TTG2, anti-LIM domain only protein 2, anti-LMO2, anti-RHOM2, anti-RBTN2
Reference ARO-A16441
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen LMO2
Clone Name SAA0919
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16441-50
Uniprot ID P25791
Raw Antigen Sequence MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-RBTNL1, anti-Rhombotin-2, anti-T-cell translocation protein 2, anti-LMO-2, anti-Cysteine-rich protein TTG-2, anti-TTG2, anti-LIM domain only protein 2, anti-LMO2, anti-RHOM2, anti-RBTN2
Reference ARO-A16441
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen LMO2
Clone Name SAA0919
Target species Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Human LMO2 VHH (SAA0919)

SDS-PAGE for Anti-Human LMO2 VHH (SAA0919)

Anti-Human LMO2 VHH (SAA0919), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human LMO2 VHH (SAA0919)

There are no reviews yet.

Be the first to review “Anti-Human LMO2 VHH (SAA0919)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products