Brand:

Anti-Human MMP13 Monoclonal Antibody (40E09#)

PTX25216-50
Validated ELISA FC

Original price was: $428.00.Current price is: $315.00.

50ug 26% OFF + 315 loyalty points

Size Size

50ug Original price was: $428.00.Current price is: $315.00.
100ug Original price was: $622.00.Current price is: $451.00.
1MG Original price was: $1,609.00.Current price is: $1,308.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Datasheet

Anti-Human MMP13 Monoclonal Antibody (40E09#)

Product name	PTX25216-100
Uniprot ID	P45452
Raw Antigen Sequence	MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mouse
Clonality	Polyclonal Antibody

Product name	PTX25216-1MG
Uniprot ID	P45452
Raw Antigen Sequence	MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mouse
Clonality	Polyclonal Antibody

Product name	PTX25216-50
Uniprot ID	P45452
Raw Antigen Sequence	MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mouse
Clonality	Polyclonal Antibody

Datasheet

SDS-PAGE for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Anti-Human MMP13 Monoclonal Antibody (40E09#), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow-cytometry using anti-human MMP13 antibody.MDA-MB-231 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human MMP13 antibody monoclonal antibody (Catalog # PTX25216 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow-cytometry using anti-human MMP13 antibody.HeLa cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human MMP13 antibody monoclonal antibody (Catalog # PTX25216 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human MMP13 Monoclonal Antibody (40E09#) binds to Recombinant Human MMP13, N-His in ELISA Assay

Recombinant Human MMP13, N-His(cat. No.ARO-P13754) at 0.5µg/mL (100µL/well) can bind Anti-Human MMP13 Monoclonal Antibody (40E09#) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Anti-Human MMP13 Monoclonal Antibody (40E09#)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human MMP13 Monoclonal Antibody (40E09#)

Anti-Human MMP13 Monoclonal Antibody (40E09#)

SDS-PAGE for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Anti-Human MMP13 Monoclonal Antibody (40E09#) binds to Recombinant Human MMP13, N-His in ELISA Assay

Related products

Recombinant Human MMP13, N-His

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human MMP13 Monoclonal Antibody (40E09#)

Specifications Anti-Human MMP13 Monoclonal Antibody (40E09#)

Documents

QC & Validation

SDS-PAGE for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Anti-Human MMP13 Monoclonal Antibody (40E09#) binds to Recombinant Human MMP13, N-His in ELISA Assay

Reviews

Related products

Recombinant Human MMP13, N-His

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human MMP13 Monoclonal Antibody (40E09#)