Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand:

Anti-Human MMP13 Monoclonal Antibody (40E09#)

  • PTX25216-50
  • Validated ELISA FC

Original price was: $428.00.Current price is: $315.00.

50ug 26% OFF + 315 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human MMP13 Monoclonal Antibody (40E09#)

Product name PTX25216-100
Uniprot ID P45452
Raw Antigen Sequence MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mouse
Clonality Polyclonal Antibody
Product name PTX25216-1MG
Uniprot ID P45452
Raw Antigen Sequence MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mouse
Clonality Polyclonal Antibody
Product name PTX25216-50
Uniprot ID P45452
Raw Antigen Sequence MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mouse
Clonality Polyclonal Antibody

SDS-PAGE for Anti-Human MMP13 Monoclonal Antibody (40E09#)

SDS-PAGE for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Anti-Human MMP13 Monoclonal Antibody (40E09#), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow-cytometry using anti-human MMP13 antibody.MDA-MB-231 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human MMP13 antibody monoclonal antibody (Catalog # PTX25216 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow-cytometry using anti-human MMP13 antibody.HeLa cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human MMP13 antibody monoclonal antibody (Catalog # PTX25216 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human MMP13 Monoclonal Antibody (40E09#) binds to Recombinant Human MMP13, N-His in ELISA Assay

Anti-Human MMP13 Monoclonal Antibody (40E09#) binds to Recombinant Human MMP13, N-His in ELISA Assay

Recombinant Human MMP13, N-His(cat. No.ARO-P13754) at 0.5µg/mL (100µL/well) can bind Anti-Human MMP13 Monoclonal Antibody (40E09#) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Anti-Human MMP13 Monoclonal Antibody (40E09#)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products