Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

  • ARO-A14959-50
  • Validated ELISA

Original price was: $424.00.Current price is: $324.00.

50ug 24% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

Product name ARO-A14959-100
Uniprot ID Q86YL7
Raw Antigen Sequence MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14959
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Podoplanin, Aggrus, Glycoprotein 36, Gp36, PA2.26 antigen, T1-alpha, T1A, 29kDa cytosolic podoplanin intracellular domain, PICD, PDPN, GP36, PSEC0003, PSEC0025
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14959-1MG
Uniprot ID Q86YL7
Raw Antigen Sequence MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14959
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Podoplanin, Aggrus, Glycoprotein 36, Gp36, PA2.26 antigen, T1-alpha, T1A, 29kDa cytosolic podoplanin intracellular domain, PICD, PDPN, GP36, PSEC0003, PSEC0025
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14959-50
Uniprot ID Q86YL7
Raw Antigen Sequence MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14959
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Podoplanin, Aggrus, Glycoprotein 36, Gp36, PA2.26 antigen, T1-alpha, T1A, 29kDa cytosolic podoplanin intracellular domain, PICD, PDPN, GP36, PSEC0003, PSEC0025
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

SEC-HPLC of Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)was analyzed by size exclusion chromatography with UV detection.

Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

There are no reviews yet.

Be the first to review “Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products