Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human NPPB Antibody (SAA0281)

Original price was: $521.00.Current price is: $407.00.

100ug 22% OFF + 407 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human NPPB Antibody (SAA0281)

Product name ARO-A15395-100
Uniprot ID P16860
Raw Antigen Sequence MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15395
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen NT-proBNP(1-76),preproBNP,BNP(1-32),BNP(4-32),proBNP,Brain natriuretic peptide,BNP,des-SerPro-BNP,NPPB,NT-pro-BNP,proBNP(79-108),Iso-ANP,Natriuretic peptides B,Gamma-brain natriuretic peptide,Brain natriuretic factor prohormone,BNP-32,
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15395-1MG
Uniprot ID P16860
Raw Antigen Sequence MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15395
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen NT-proBNP(1-76),preproBNP,BNP(1-32),BNP(4-32),proBNP,Brain natriuretic peptide,BNP,des-SerPro-BNP,NPPB,NT-pro-BNP,proBNP(79-108),Iso-ANP,Natriuretic peptides B,Gamma-brain natriuretic peptide,Brain natriuretic factor prohormone,BNP-32,
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15395-50
Uniprot ID P16860
Raw Antigen Sequence MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15395
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen NT-proBNP(1-76),preproBNP,BNP(1-32),BNP(4-32),proBNP,Brain natriuretic peptide,BNP,des-SerPro-BNP,NPPB,NT-pro-BNP,proBNP(79-108),Iso-ANP,Natriuretic peptides B,Gamma-brain natriuretic peptide,Brain natriuretic factor prohormone,BNP-32,
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human NPPB Antibody (SAA0281)

SDS-PAGE for Anti-Human NPPB Antibody (SAA0281)

Anti-Human NPPB Antibody (SAA0281), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human NPPB Antibody (SAA0281)

There are no reviews yet.

Be the first to review “Anti-Human NPPB Antibody (SAA0281)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products