Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human OSM/Oncostatin-M (GSK315234)

  • PTX26144-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $407.00.Current price is: $315.00.

50ug 23% OFF + 315 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human OSM/Oncostatin-M (GSK315234)

Product name PTX26144-100
Uniprot ID P13725
Raw Antigen Sequence MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-OSM, Anti-Oncostatin-M, GSK315234
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name OSM
Product name PTX26144-1MG
Uniprot ID P13725
Raw Antigen Sequence MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-OSM, Anti-Oncostatin-M, GSK315234
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name OSM
Product name PTX26144-50
Uniprot ID P13725
Raw Antigen Sequence MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-OSM, Anti-Oncostatin-M, GSK315234
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name OSM

Flow Cytometry results for Anti-Human OSM/Oncostatin-M (GSK315234)

Flow Cytometry results for Anti-Human OSM/Oncostatin-M (GSK315234)

Flow-cytometry using anti-human OSM antibody. KG-1 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an anti-human OSM monoclonal antibody (Catalog PTX26144, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human OSM/Oncostatin-M (GSK315234) binds to Recombinant Human OSM/Oncostatin-M Protein, N-His in WB Assay

Anti-Human OSM/Oncostatin-M (GSK315234) binds to Recombinant Human OSM/Oncostatin-M Protein, N-His in WB Assay

Recombinant Human OSM/Oncostatin-M Protein, N-His(cat. No.ARO-P14734) can bind Anti-Human OSM/Oncostatin-M (GSK315234) in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Human OSM/Oncostatin-M (GSK315234)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products