Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human PPBP/CXCL7/NAP-2 Antibody (SAA0464), APC

Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG2a, kappa
Target species:
Human
Clone Name:
SAA0464

Original price was: $514.00.Current price is: $370.00.

50ug 28% OFF + 370 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human PPBP/CXCL7/NAP-2 Antibody (SAA0464), APC

Product name ARO-A10382-100
Uniprot ID P02775
Raw Antigen Sequence MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-NAP-2, NAP-2(1-63), NAP-2(73), PPBP, CXCL7, PBP, Small-inducible cytokine B7, Macrophage-derived growth factor, LA-PF4, Leukocyte-derived growth factor, CTAP-III, CTAP-III(1-81), Low-affinity platelet factor IV, TGB1, Beta-TG, C-X-C motif chemokine 7, MDGF, Platelet basic protein, LDGF, NAP-2(74), THBGB1, NAP-2(1-66), CTAP3, SCYB7
Reference ARO-A10382
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target NAP-2, NAP-2(1-63), NAP-2(73), PPBP, CXCL7, PBP, Small-inducible cytokine B7, Macrophage-derived growth factor, LA-PF4, Leukocyte-derived growth factor, CTAP-III, CTAP-III(1-81), Low-affinity platelet factor IV, TGB1, Beta-TG, C-X-C motif chemokine 7, MDGF, Platelet basic protein, LDGF, NAP-2(74), THBGB1, NAP-2(1-66), CTAP3, SCYB7
Clone Name SAA0464
Target species Human
Product name ARO-A10382-1MG
Uniprot ID P02775
Raw Antigen Sequence MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-NAP-2, NAP-2(1-63), NAP-2(73), PPBP, CXCL7, PBP, Small-inducible cytokine B7, Macrophage-derived growth factor, LA-PF4, Leukocyte-derived growth factor, CTAP-III, CTAP-III(1-81), Low-affinity platelet factor IV, TGB1, Beta-TG, C-X-C motif chemokine 7, MDGF, Platelet basic protein, LDGF, NAP-2(74), THBGB1, NAP-2(1-66), CTAP3, SCYB7
Reference ARO-A10382
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target NAP-2, NAP-2(1-63), NAP-2(73), PPBP, CXCL7, PBP, Small-inducible cytokine B7, Macrophage-derived growth factor, LA-PF4, Leukocyte-derived growth factor, CTAP-III, CTAP-III(1-81), Low-affinity platelet factor IV, TGB1, Beta-TG, C-X-C motif chemokine 7, MDGF, Platelet basic protein, LDGF, NAP-2(74), THBGB1, NAP-2(1-66), CTAP3, SCYB7
Clone Name SAA0464
Target species Human
Product name ARO-A10382-50
Uniprot ID P02775
Raw Antigen Sequence MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-NAP-2, NAP-2(1-63), NAP-2(73), PPBP, CXCL7, PBP, Small-inducible cytokine B7, Macrophage-derived growth factor, LA-PF4, Leukocyte-derived growth factor, CTAP-III, CTAP-III(1-81), Low-affinity platelet factor IV, TGB1, Beta-TG, C-X-C motif chemokine 7, MDGF, Platelet basic protein, LDGF, NAP-2(74), THBGB1, NAP-2(1-66), CTAP3, SCYB7
Reference ARO-A10382
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target NAP-2, NAP-2(1-63), NAP-2(73), PPBP, CXCL7, PBP, Small-inducible cytokine B7, Macrophage-derived growth factor, LA-PF4, Leukocyte-derived growth factor, CTAP-III, CTAP-III(1-81), Low-affinity platelet factor IV, TGB1, Beta-TG, C-X-C motif chemokine 7, MDGF, Platelet basic protein, LDGF, NAP-2(74), THBGB1, NAP-2(1-66), CTAP3, SCYB7
Clone Name SAA0464
Target species Human

There are no reviews yet.

Be the first to review “Anti-Human PPBP/CXCL7/NAP-2 Antibody (SAA0464), APC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products