Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

  • ARO-A15014-100
  • Validated ELISA WB

Original price was: $633.00.Current price is: $462.00.

100ug 27% OFF + 462 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)
Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)
Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

Product name ARO-A15014-100
Uniprot ID P12272
Raw Antigen Sequence MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human, Mouse
Reference ARO-A15014
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Parathyroid hormone-like protein, PTHrP, PTH-rP, Parathyroid hormone-related protein, PTHrP[107-139], PLP, PTHRP, PTHLH
Target species Anti-Human, Mouse Monoclonal Antibody
Product name ARO-A15014-1MG
Uniprot ID P12272
Raw Antigen Sequence MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human, Mouse
Reference ARO-A15014
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Parathyroid hormone-like protein, PTHrP, PTH-rP, Parathyroid hormone-related protein, PTHrP[107-139], PLP, PTHRP, PTHLH
Target species Anti-Human, Mouse Monoclonal Antibody
Product name ARO-A15014-50
Uniprot ID P12272
Raw Antigen Sequence MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human, Mouse
Reference ARO-A15014
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Parathyroid hormone-like protein, PTHrP, PTH-rP, Parathyroid hormone-related protein, PTHrP[107-139], PLP, PTHRP, PTHLH
Target species Anti-Human, Mouse Monoclonal Antibody

SDS-PAGE for Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

SDS-PAGE for Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

There are no reviews yet.

Be the first to review “Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products